KEGG   Klebsiella aerogenes KCTC 2190: EAE_14280Help
Entry
EAE_14280         CDS       T01529                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00260  Glycine, serine and threonine metabolism
eae00680  Methane metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
eae01230  Biosynthesis of amino acids
Module
eae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eae_M00002  Glycolysis, core module involving three-carbon compounds
eae_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_14280 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EAE_14280 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAE_14280 (gpmA)
Enzymes [BR:eae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EAE_14280 (gpmA)
Membrane trafficking [BR:eae04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EAE_14280 (gpmA)
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EAE_14280 (gpmA)
  Exosomal proteins of melanoma cells
   EAE_14280 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 10793078
NCBI-ProteinID: YP_004593048
UniProt: A0A0H3FT42
Position
complement(3070429..3071181)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactagttcgtcacggcgagagccaatggaacaacgaaaac
cgtttcaccggttggtacgacgttgacctgtctgaaaaaggcgttagcgaagcgaaagcg
gcgggtaaactgctgaaggaagaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaaactgaacgaacgtcactacggcgcgctgcagggcctgaacaaa
gccgaaaccgctgagaagtatggcgacgagcaggttaaacagtggcgtcgcggctttgcc
gtcaccccgccggaactgaccaaagatgacgaacgttatccgggccacgatccgcgttac
gcgaagctgaccgatgcggaactgccgaccaccgagagcctggcgctgaccatcgaccgc
gtcgtaccttactggaacgaaaccattctgccgcgcctgaaaagcggcgagcgcgtcatt
atcgccgctcacggtaactccctgcgtgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatccttgaactgaacatcccgaccggcgtaccgctggtgtatgagttcgatgaa
aacttcaagccgatcaaacactactacctgggcaatgctgacgaaatcgctgcgaaggcc
gcggctgtcgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system