KEGG   Enterobacter aerogenes KCTC 2190: EAE_14280Help
Entry
EAE_14280         CDS       T01529                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAE_14280 (gpmA)
   01230 Biosynthesis of amino acids
    EAE_14280 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_14280 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EAE_14280 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAE_14280 (gpmA)
Enzymes [BR:eae01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EAE_14280 (gpmA)
Exosome [BR:eae04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EAE_14280 (gpmA)
  Exosomal proteins of melanoma cells
   EAE_14280 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3070429..3071181)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPTTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctggtactagttcgtcacggcgagagccaatggaacaacgaaaac
cgtttcaccggttggtacgacgttgacctgtctgaaaaaggcgttagcgaagcgaaagcg
gcgggtaaactgctgaaggaagaaggcttcagctttgattttgcttatacctccgtgctg
aaacgtgccatccacaccctgtggaacgtgctggacgaactggatcaggcctggctgccg
gttgagaaatcctggaaactgaacgaacgtcactacggcgcgctgcagggcctgaacaaa
gccgaaaccgctgagaagtatggcgacgagcaggttaaacagtggcgtcgcggctttgcc
gtcaccccgccggaactgaccaaagatgacgaacgttatccgggccacgatccgcgttac
gcgaagctgaccgatgcggaactgccgaccaccgagagcctggcgctgaccatcgaccgc
gtcgtaccttactggaacgaaaccattctgccgcgcctgaaaagcggcgagcgcgtcatt
atcgccgctcacggtaactccctgcgtgcgctggtgaaatacctcgacaacatgggcgaa
gacgagatccttgaactgaacatcccgaccggcgtaccgctggtgtatgagttcgatgaa
aacttcaagccgatcaaacactactacctgggcaatgctgacgaaatcgctgcgaaggcc
gcggctgtcgctaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system