KEGG   Enterobacter aerogenes KCTC 2190: EAE_15550Help
Entry
EAE_15550         CDS       T01529                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:eae00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EAE_15550
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    EAE_15550
Enzymes [BR:eae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     EAE_15550
Two-component system [BR:eae02022]
 CheA family
  CheA-CheYBV
   EAE_15550
Bacterial motility proteins [BR:eae02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    EAE_15550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3362561..3363610
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIVNGHADMEMVAVAPDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEITLRALELGAVDFVTKPQLGIREGMLAYS
ELIGEKIRTAARARLPQRANDQPPAILSHGPLLSSEKLIAIGASTGGTEAIRQVLQPLPA
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEEGERVLPGHAYIAPGDRHLELARSG
ANYQVKLHDGPAVNRHRPSVDVLFRSVARHAGRNAVGVILTGMGNDGAQGMLEMHRAGAY
TLAQSEASCVVFGMPREAIASGGVNEVVELERMSQRMLAQIAGGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtgttatgtgttgatgattcggccctgatgcgccagttgatgacc
gagatcgtcaatggccacgccgatatggagatggtggcggtggccccggacccgctggtc
gcacgggatctgatcaaaaaatttaacccacaggtgctgacgctggacgtcgaaatgccg
cgtatggacggcctcgatttcctcgaaaagctgatgcgcctgcggccgatgccggtggtg
atggtttcatcgctgaccggtaaaggttcggaaattaccctgcgcgcgctggagctgggg
gcggtggatttcgtcaccaaaccgcagctcgggatccgcgaaggcatgctggcctacagc
gaactgataggcgaaaagatccgtaccgccgcacgggcgcggctgccgcagcgggccaat
gaccagccgccggccattttaagccacggaccgctgctgagcagcgagaagctgatcgcc
attggcgcttccaccggcggcaccgaagcgattcgtcaggtgctacaaccgttgccggcc
accagtccggcgctgcttatcacccagcatatgccgccgggatttacccgctcgtttgcc
gaacggttgaataagctgtgccagatcacggtgaaagaggcggaagagggcgaacgcgtg
ctcccgggacacgcctatatcgcgcctggggatcgccatctggagctggcgcgtagcggc
gctaactatcaggtcaagttgcacgacggcccggcggtaaatcgccatcgtccctcggtg
gatgtgctgtttcgctcggtggcccggcacgccgggcgcaatgcggtgggggtgatcctc
accggcatgggcaacgacggcgcgcaggggatgctggagatgcatcgcgccggggcctat
accctggcgcagagtgaggcgagctgcgtggtgttcggcatgccgcgcgaggccatcgcc
agcggtggggtcaacgaagtggttgaactggagcgcatgagccaacgcatgctggcgcag
atcgccggcggccaggcgctgcgaatttaa

DBGET integrated database retrieval system