KEGG   Enterobacter aerogenes KCTC 2190: EAE_16440Help
Entry
EAE_16440         CDS       T01529                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eae00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:eae00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3546399..3547421
Genome map
AA seq 340 aa AA seqDB search
MGPVMLDVEGFELDAEEREILAHPLVGGLILFTRNYHDPAQLRELVRQIREASRNHLVVA
VDQEGGRVQRFREGFTRLPAAQSFAALLGVEEGGKLAAEAGWLMASEMIAMDIDISFAPV
LDVGHISAAIGERSWHEDPQKALVMARHFIDGMHAAGMKTTGKHFPGHGAVTADSHKETP
FDPRPAAEIRAKDMAVFKSLIDEQRLDAIMPAHVIYSDIDPRPASGSEYWLKTVLRGELG
FDGVIFSDDLSMEGAAIMGSYAERGQASLDAGCDMILVCNNRKGAVSVLDNLSPIKAERV
TKLYHKGSFTRQELRDSARWQTVSAQLEQLHARWQEAKSV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
gtgggtccggtaatgttggatgtcgaaggttttgaactggatgcggaagagcgtgagatt
ctggctcatcctttggtcggcggcttaattttgtttacccgcaactaccacgatccggcg
cagttgcgcgaactggtacgccaaatccgcgaggcctcgcgtaatcatctcgtggtggcg
gtggatcaggaaggtgggcgtgtgcagcgctttcgcgaaggttttacccgtctgccggcc
gcgcagtcttttgccgcgctgctgggggtggaagagggcggtaagctcgccgcagaagcc
ggttggctgatggccagcgaaatgattgccatggatattgatatcagcttcgcgccggtg
ctggatgtggggcacatcagcgctgcgatcggcgaacgctcatggcatgaagacccgcaa
aaggcgctggtgatggcgcgtcatttcattgacggtatgcatgccgccggtatgaaaacc
accggtaaacacttcccgggccacggcgcggtgacggcggattcacacaaagagacaccg
tttgatccgcgtccggcagcggaaatccgtgctaaagatatggcggtgttcaagagcctg
atcgatgaacaacgcctggatgcgattatgccggcgcatgtgatttactctgacatcgat
ccgcgcccggcgagtggttcagaatactggctgaaaacggtgctgcgcggcgagctgggc
tttgatggcgtcatcttctcagacgacctgtcgatggaaggggcggcgatcatgggcagc
tatgctgaacgtgggcaggcatcgctcgatgccggttgcgatatgatcctggtctgcaat
aatcgtaaaggcgcggtgagcgtattggataacctgtccccgatcaaagcagagcgtgtt
acaaaattgtatcataaaggttcatttacccgtcaggaactgcgagattccgctcgttgg
caaacggtaagcgcacagctggaacagctccatgcgcgctggcaagaagcgaagtctgtg
tag

DBGET integrated database retrieval system