KEGG   Klebsiella aerogenes KCTC 2190: EAE_16880Help
Entry
EAE_16880         CDS       T01529                                 

Definition
(RefSeq) UTP--glucose-1-phosphate uridylyltransferase subunit GalU
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00040  Pentose and glucuronate interconversions
eae00052  Galactose metabolism
eae00500  Starch and sucrose metabolism
eae00520  Amino sugar and nucleotide sugar metabolism
eae01100  Metabolic pathways
eae01130  Biosynthesis of antibiotics
Module
eae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAE_16880
   00052 Galactose metabolism
    EAE_16880
   00500 Starch and sucrose metabolism
    EAE_16880
   00520 Amino sugar and nucleotide sugar metabolism
    EAE_16880
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAE_16880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N DUF4833
Motif
Other DBs
NCBI-GeneID: 10793601
NCBI-ProteinID: YP_004593566
UniProt: A0A0H3FZI5
Position
3647581..3648483
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLTRDNLAEMIVRFDETGASQIMVEPVEDVTAYGV
VDCKGESLQPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGVRHKTLGEDFKAWLAQAVAK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtaagaaaagctgttatcccggtagcgggattaggcacc
aggatgctacccgccaccaaggctattccgaaagaaatgctgccactggtagataaacca
ttaatccaatatgttgttaacgaatgtatcgccgctgggattactgaaattgttctggtg
acacactcttcgaaaaattctattgaaaaccatttcgataccagcttcgaactcgaagcg
atgctggaaaaacgtgtaaaacgtcagcttctggaagaagttcagtctatctgtccgccg
cacgtcaccattatgcaggtacgtcaggggctggctaaaggtctgggccacgcggtgctg
tgcgcgcatccggttgtcggcgatgagccggttgcggttattctgcccgacgtgattctg
gacgaatatgagtccgatctgacccgtgataacctggcggagatgattgttcgctttgac
gaaacgggcgccagccagatcatggttgagccggttgaagacgtcaccgcttatggtgtt
gttgactgcaaaggcgaaagcctgcagcctggcgaaagcgtgccgatggttggcgttgtt
gagaaaccaaaagcagacgtcgcgccgtctaatctggcggtagtcggtcgttatgtgctg
agcgccgatatttggccgctgctggcgaaaacccctccgggagccggtgatgaaattcag
ctgacagatgctatcgatatgctgatcgagaaagaaaccgtagaagcttaccacatgaaa
ggcaaaagccatgactgcggtaataagctcggctatatgcaggccttcgtagaatatggc
gttcgccataaaactctgggcgaagactttaaagcctggcttgcgcaagcggtcgcgaag
taa

DBGET integrated database retrieval system