KEGG   Enterobacter aerogenes KCTC 2190: EAE_16880Help
Entry
EAE_16880         CDS       T01529                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase subunit GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAE_16880
   00052 Galactose metabolism
    EAE_16880
   00500 Starch and sucrose metabolism
    EAE_16880
   00520 Amino sugar and nucleotide sugar metabolism
    EAE_16880
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAE_16880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3647581..3648483
Genome map
AA seq 300 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEYESDLTRDNLAEMIVRFDETGASQIMVEPVEDVTAYGV
VDCKGESLQPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDAIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGVRHKTLGEDFKAWLAQAVAK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atggctgcccttaattctaaagtaagaaaagctgttatcccggtagcgggattaggcacc
aggatgctacccgccaccaaggctattccgaaagaaatgctgccactggtagataaacca
ttaatccaatatgttgttaacgaatgtatcgccgctgggattactgaaattgttctggtg
acacactcttcgaaaaattctattgaaaaccatttcgataccagcttcgaactcgaagcg
atgctggaaaaacgtgtaaaacgtcagcttctggaagaagttcagtctatctgtccgccg
cacgtcaccattatgcaggtacgtcaggggctggctaaaggtctgggccacgcggtgctg
tgcgcgcatccggttgtcggcgatgagccggttgcggttattctgcccgacgtgattctg
gacgaatatgagtccgatctgacccgtgataacctggcggagatgattgttcgctttgac
gaaacgggcgccagccagatcatggttgagccggttgaagacgtcaccgcttatggtgtt
gttgactgcaaaggcgaaagcctgcagcctggcgaaagcgtgccgatggttggcgttgtt
gagaaaccaaaagcagacgtcgcgccgtctaatctggcggtagtcggtcgttatgtgctg
agcgccgatatttggccgctgctggcgaaaacccctccgggagccggtgatgaaattcag
ctgacagatgctatcgatatgctgatcgagaaagaaaccgtagaagcttaccacatgaaa
ggcaaaagccatgactgcggtaataagctcggctatatgcaggccttcgtagaatatggc
gttcgccataaaactctgggcgaagactttaaagcctggcttgcgcaagcggtcgcgaag
taa

DBGET integrated database retrieval system