KEGG   Enterobacter aerogenes KCTC 2190: EAE_16895Help
Entry
EAE_16895         CDS       T01529                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EAE_16895
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_16895
   00620 Pyruvate metabolism
    EAE_16895
   00650 Butanoate metabolism
    EAE_16895
  Lipid metabolism
   00071 Fatty acid degradation
    EAE_16895
  Amino acid metabolism
   00350 Tyrosine metabolism
    EAE_16895
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EAE_16895
   00626 Naphthalene degradation
    EAE_16895
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EAE_16895
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EAE_16895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3650366..3653044)
Genome map
AA seq 892 aa AA seqDB search
MAVTNVAELNALVERVKKAQREYASFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYLLQGKELKAVQDIILKNGALNAAIVGQP
AAKIAELAGFTVPATTKILIGEVTDVDESEPFAHEKLSPTLAMYRAKDFEDAVNKAEKLV
AMGGIGHTSCLYTDQDNQPARVAYFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLTIVRKGADLANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMVAITTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKEYLPASYHEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAPGDRTAAKIEKLLAWLESLKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLIAELKQILLDTYYGRDFVEGEAAAVKKEAAPAKAEKKAKKSA
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaatgtcgctgaacttaacgcacttgtagagcgcgtaaaaaaagcccag
cgtgaatatgccagtttcactcaagaacaagttgataagatcttccgtgccgccgctctg
gccgctgcagatgctcgaatccctctcgctaaaatggctgttgccgaatccggcatgggt
attattgaagataaagtgatcaaaaaccacttcgcttccgaatatatctacaacgcctat
aaagatgaaaagacctgtggcgtcctgtctgaagacgacactttcggtaccatcaccatt
gctgagccaatcggtattatttgcggtatcgtcccgactaccaacccgacttctactgct
atcttcaaatcgctgatcagcctgaagacgcgtaacgccatcatcttctctccgcacccg
cgtgctaaagacgcgactaacaaagcggcggacatcgtattgcaggcggcgattgccgca
ggcgcgccgaaagatctgatcggttggatcgaccagccttccgtagaactgtctaacgca
ctaatgcatcatcctgacatcaacctgatcctcgccaccggcggcccaggtatggttaag
gcggcttatagctccggtaaaccagctatcggcgttggcgcgggcaacacgccggttgtt
attgatgaaacggctgatatcaaacgcgcagtggcgtctgtactgatgtcgaaaaccttc
gataacggcgttatctgtgcttctgaacaatccgtggtggttgtcgactccgtctacgac
gccgtccgcgagcgttttgccagccatggcggctacctgctgcagggtaaagagctgaaa
gccgttcaggacatcatcctgaaaaatggcgcgctgaatgcggcgatcgttggtcaacca
gcggcaaaaatcgctgaactggcaggcttcaccgtgccagctaccactaagattctgatc
ggcgaagttaccgacgttgacgaaagcgaaccgttcgctcacgaaaaactgtctccgacg
ctggcaatgtaccgtgcgaaagatttcgaagacgcggtcaataaagcagaaaaactggtc
gccatgggcggtatcggtcacacctcttgcctgtacaccgaccaggacaaccagccggct
cgcgtggcctacttcggccagatgatgaaaaccgcgcgtatcctgatcaacaccccggct
tcccagggtggtatcggcgacctgtataacttcaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccgaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcataaacttccgaaatctatc
tacttccgtcgtggctcactgccaatcgcactggatgaagtgattactgatggtcacaaa
cgcgcgctgattgtgactgaccgcttcctgttcaacaacggttacgcggaccagatcact
tccgtactgaaagcggctggcgtagaaaccgaagtgttctttgaagttgaagctgaccca
acgctgactatcgtgcgtaaaggcgcggatctggccaactccttcaaaccagacgtaatc
atcgccctgggcggcggttccccgatggatgcggcaaaaatcatgtgggtcatgtacgag
cacccggaaacccacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtcaaagccaagatggttgccattaccaccacctccggt
accggttctgaagttaccccgttcgccgtagtaaccgacgatgcaactggacagaaatat
ccgctggctgactacgctctgactccggatatggcgattgtcgatgccaacctggtcatg
gatatgccgaagtctctctgtgccttcggtggtctggatgccgtgactcacgctctggaa
gcttacgtctccgtactggcttctgagttctccgatggtcaggctctgcaggcgctgaaa
ctgctgaaagagtatctgccggcctcttaccatgaaggttctaagaacccggtagcccgc
gaacgtgtgcacagcgccgccactatcgccggtatcgcgtttgctaacgccttcctcggc
gtgtgccactcaatggcgcacaaactgggctcgcagttccacattcctcacggtctggca
aacgccctgctgatcagcaacgttatccgctataacgcgaatgacaacccgaccaagcag
accgcattcagccagtatgaccgtccgcaggcgcgccgtcgctacgctgagatcgcagac
cacctgggcctgagcgctccgggcgaccgcactgcggcgaaaatcgagaaactgctggca
tggctggaaagcctcaaagctgaactgggtattccgaaatctattcgcgaagccggcgtt
caggaagctgatttcctggctcacgttgataagctgtctgaagacgccttcgatgaccag
tgcaccggcgctaacccgcgctacccgctgatcgccgagctgaaacagattctgctggat
acctactacggtcgtgactttgtagaaggtgaagcggcggctgtgaaaaaagaagcggct
ccggccaaagctgagaaaaaagcgaaaaaatccgcttaa

DBGET integrated database retrieval system