KEGG   Klebsiella aerogenes KCTC 2190: EAE_16965Help
Entry
EAE_16965         CDS       T01529                                 

Definition
(RefSeq) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00030  Pentose phosphate pathway
eae00051  Fructose and mannose metabolism
eae00052  Galactose metabolism
eae00680  Methane metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01200  Carbon metabolism
eae01230  Biosynthesis of amino acids
Module
eae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_16965
   00030 Pentose phosphate pathway
    EAE_16965
   00051 Fructose and mannose metabolism
    EAE_16965
   00052 Galactose metabolism
    EAE_16965
  Energy metabolism
   00680 Methane metabolism
    EAE_16965
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EAE_16965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin DUF2617 Carb_kinase
Motif
Other DBs
NCBI-GeneID: 10793618
NCBI-ProteinID: YP_004593583
UniProt: A0A0H3FZJ7
Position
complement(3666281..3667213)
Genome map
AA seq 310 aa AA seqDB search
MTKIYTLTLAPSLDSATLTPQIYPEGKLRCSAPVFEPGGGGINVARAITFLGGKATAIFP
IGGATGEHLTALMADEQVPVETVETRDWTRQNLHVHVDASGEQYRFVMPGAALTEEEFRR
LEEKVLAIEPGSLLVISGSLPPGISVEHLTQLVKNAQQHGLRCIIDSSGDALAAALDVGN
IELVKPNQKELSALVQRDLSQPDDVRNAALELIRSGKVRRVVVSLGPQGALGVDATGSVQ
VVPPPMKSQSTVGAGDSMVGAMTLRLAEHASLEDMVRFGVAAGSAATINHGTRLCSLTNT
QKIYDYLCGR
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaaatttatacgctcacgctggccccatcactcgatagcgcaacgctgacaccg
caaatataccctgaaggcaagttacgctgtagcgcaccggtattcgaacccggaggcggc
ggaatcaacgtcgcccgggccattacctttctgggcggtaaagcgactgcgattttcccg
attgggggcgccaccggcgagcatcttaccgccctgatggctgatgagcaggtcccggtc
gaaacagtagaaacccgcgactggacgcggcagaacttacatgtgcatgtcgatgccagc
ggcgaacaatatcgctttgtcatgcccggcgcggcgctaaccgaagaggagttccgtcgc
ctggaagagaaagtactcgcgattgagcccggttctctgctggttatcagcggcagtctg
ccgcccggaatcagcgtcgagcatctgactcaactggtaaaaaacgcgcagcagcacggg
ctacgttgcatcatcgacagctccggcgatgcgctggccgccgcgctggatgtcggcaac
atcgagctggtcaaaccgaaccagaaagagcttagcgcgctggtacagcgcgacctcagc
cagcctgacgacgtgcgtaatgccgcgctggaactgatccgctccggaaaagtacgccgg
gttgtggtttcgctgggtccgcagggggcgctgggagttgatgccaccggcagcgtacag
gtggtgccgccaccgatgaaaagccagagcaccgttggcgcgggtgacagtatggtcggc
gcaatgacgctacgtctggcggaacatgcctcgcttgaggatatggtccgctttggcgtt
gccgctggtagcgccgccacgattaaccacggcacccgcctgtgttcattaaccaacacg
cagaaaatctacgattacctgtgtggccgctag

DBGET integrated database retrieval system