KEGG   Enterobacter aerogenes KCTC 2190: EAE_17040Help
Entry
EAE_17040         CDS       T01529                                 

Gene name
btuE
Definition
putative glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eae00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:eae00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3682447..3682998
Genome map
AA seq 183 aa AA seqDB search
MQHDILNTEVTTIDGEKTTLAAYAGKVLLIVNVASYCGLTPQYEQLEALQEEFAPQGFSV
LGFPCNQFLGQEPGSEEEIKTFCSVTYGITFPLFSKIDVNGEHRAPLYQKLIAAAPKAVA
PEGSGFYERMASKGRAPLYVDDILWNFEKFLVGRDGQVIQRFSPDMTPDDPQLLAAVKGA
LAQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcaacacgacattcttaataccgaagtgacgaccatcgatggcgaaaaaaccaccctg
gcggcgtatgccggaaaggtgctgctgatcgtcaacgtggcctcatactgcggcctcacg
ccgcagtatgagcaactggaagcgctgcaagaagagtttgccccgcagggattcagcgtc
cttggcttcccttgtaatcagtttctcggccaggagccgggcagcgaagaagagattaaa
acgttctgcagcgtgacctacggcatcaccttcccgctgttcagtaaaattgacgtcaac
ggcgaacatcgcgcgccgctgtatcaaaaattgattgccgccgcgccgaaggccgtcgcg
ccggaagggagcggtttctatgagcggatggccagtaaaggccgcgcgccgctgtacgtt
gacgacatcctgtggaactttgaaaaattcctcgtgggccgcgatggtcaggtgattcag
cgtttctcgccggatatgacgccggacgatccgcaactgctggctgcggtaaaaggagca
ttagcgcaataa

DBGET integrated database retrieval system