KEGG   Enterobacter aerogenes KCTC 2190: EAE_17510Help
Entry
EAE_17510         CDS       T01529                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:eae00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:eae00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3781648..3782418)
Genome map
AA seq 256 aa AA seqDB search
MNLNGKTALVTGSTSGIGLGIAKVLAQAGAQLVLNGFGDSTSARAEVAALGKIPGYHDAD
LRDVGQIEAMMRYTESEFGGVDIVINNAGIQHVAPVEQFAVEKWNDILAINLSSVFHTSR
LALPGMRERNWGRIINIASVHGLVASKEKSAYVAAKHGVIGFSKTLALETARTGITCNAI
CPGWVLTPLVQQQIDKRIAEGADPEQARAQLLAEKQPSGEFVTPQQLGEMALFLCSDAAA
QVRGAAWNMDGGWVAQ
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaacggtaaaacagcgctggtcaccggctccaccagcggtattggtttaggc
attgccaaagtgctggcgcaggccggcgcgcagctggtgttgaatggttttggcgacagc
acgagcgcgcgagccgaggttgccgcactgggtaaaattcccggctatcacgatgccgac
ctgcgtgacgtcgggcaaattgaagcgatgatgcgttataccgaaagcgaatttggcggc
gtcgatattgtgattaataacgccggtatccagcatgtggcgccagtggagcagttcgcg
gtggaaaaatggaacgatattctggcgataaatctgtccagcgtcttccacaccagccgc
ctggcgctgccgggcatgcgcgagcgcaactgggggcggattattaatattgcctccgtg
catgggttagtcgcctcgaaagagaaatccgcctatgtcgccgccaagcatggggtgatt
ggttttagcaaaacgctggcgctggagaccgcgcgtaccggcattacctgcaacgcgatt
tgccccggctgggtactgacgccgctggttcagcaacagatcgataaacgtatcgctgag
ggggccgaccctgagcaggccagagcgcagctgcttgccgaaaaacaaccctccggcgaa
ttcgtgacgcctcagcaactgggggaaatggcgctatttttatgcagcgacgccgccgcg
caggttcgcggcgcggcgtggaatatggatggcggctgggtggcgcagtaa

DBGET integrated database retrieval system