KEGG   Enterobacter aerogenes KCTC 2190: EAE_18090Help
Entry
EAE_18090         CDS       T01529                                 

Definition
dihydromonapterin reductase
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eae00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:eae00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3899494..3900216)
Genome map
AA seq 240 aa AA seqDB search
MAEPQPRPVLITGAGRRIGLALAHHFLNQQQPVIVSYRQHYPSIDTLREAGAVCLQADFS
SDDGILTFAEAVKAQTSGLRAIIHNASDWMAEKPGVPLSTVISRMMQIHVHAPYLLNHAL
ESLLRGFGHAASDIIHITDYVVERGSDKHIAYAASKAALDNMTRSFARKLAPEVKVNAIA
PSLIMFNEHDDAEYRKQALDKSLMKIAPGEKEIIDLIDYLFTSCYVTGRSFAVDGGRPLR
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaccacagcctcgtccggtcctgatcacaggagcaggccgccgtatcggcctc
gctctggcacaccattttttaaaccagcagcaaccggtgatcgtcagctatcgccagcat
tatccttcgattgacaccctgcgcgaagccggcgcggtgtgtctgcaggccgatttcagc
agcgacgacggtattcttaccttcgcggaagcggtgaaggcgcagaccagcgggctgcgt
gcgattattcataacgccagtgattggatggcggaaaaacccggtgtgccgttatccacg
gtgatatcgcggatgatgcagattcacgtccacgcgccctatctgcttaaccatgcgctg
gagagcctgctgcgtggttttggtcacgccgccagcgatattattcacattaccgactac
gtggtggaacgcggcagcgataagcatatcgcctatgccgccagtaaagcggcacttgat
aatatgacccgctctttcgcccgtaagctggccccggaagtgaaggtcaacgccatcgcg
ccatcgctgattatgtttaacgagcatgatgacgctgaatatcgtaaacaggcgctggat
aaatcgctgatgaaaatcgcgccgggtgaaaaagagataatcgacctcatcgattatctg
ttcaccagttgctacgtgaccggccgctctttcgctgtcgacggcggccgaccgctgcgc
tag

DBGET integrated database retrieval system