KEGG   Klebsiella aerogenes KCTC 2190: EAE_19625Help
Entry
EAE_19625         CDS       T01529                                 

Definition
(RefSeq) arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00220  Arginine biosynthesis
eae00330  Arginine and proline metabolism
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01130  Biosynthesis of antibiotics
eae01230  Biosynthesis of amino acids
Module
eae_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    EAE_19625
   00330 Arginine and proline metabolism
    EAE_19625
Enzymes [BR:eae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     EAE_19625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 10794149
NCBI-ProteinID: YP_004594111
UniProt: A0A0H3FWU6
Position
4205834..4206703
Genome map
AA seq 289 aa AA seqDB search
MPNTQSSLRLLFPQWQGGNNPPYFFGSRMLSWLAPPAQGVVEEVCVPEPGHAQLANEDGI
VGRRAIVEQLLDAQDKITRNQPETIVTLGGDCLVSLAPFAWLVEKYGDKLGVLWIDSHPD
VMTPEQFPHAHAHVLGALMGNGDAELTQVVRKPLSPGKALIAGIHSPLDVEKQFISERGI
ATLSPSELRQNPQAIDEWIARERIEYLAIHLDLDVLDPALFRAVLFARPGRGVHDFGDVA
EGKLTIAEVVNLINQAAAQAKPVGLTVAEHLPWDTLNLKNMLEALPLLS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatacccaatccagtctgcgtttgctttttccgcaatggcaaggcggcaacaat
ccgccctacttcttcggctcccggatgctgtcctggctggcgcctcctgcgcaaggcgtt
gtcgaggaggtctgtgtccccgaaccaggacacgctcaactggcaaatgaagatggaatt
gtcggccgccgggcgatcgttgaacagttgcttgatgcacaagacaaaatcactcgaaat
cagccagagaccattgtcaccttagggggcgattgcctggtctccctggctcctttcgcc
tggcttgtggaaaaatatggcgataaattgggggtattatggattgattctcacccggac
gttatgacgccagagcagttcccacatgctcatgcccacgttcttggggcgttaatgggc
aatggcgacgcggaattaacccaggtggtcagaaagccattatcaccaggcaaagcgctc
attgccgggatccatagcccgctcgatgtcgaaaaacagtttattagtgaacgcggcatc
gccaccttaagcccatcagagctgcgtcagaatccgcaggcgattgacgagtggatagcg
cgtgaacgtattgagtacctggccatccatctcgatcttgatgtcctcgacccggccctg
tttcgagcagtgctatttgctcgtccggggcgcggcgtacacgattttggcgatgtcgcc
gaagggaaactgacgattgccgaagtggttaatcttatcaatcaagccgccgctcaggcc
aaaccggtcggcctcaccgtcgccgaacacctgccctgggataccttaaacctgaagaat
atgctcgaagctctaccattattgagttaa

DBGET integrated database retrieval system