KEGG   Enterobacter aerogenes KCTC 2190: EAE_19625Help
Entry
EAE_19625         CDS       T01529                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eae01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:eae00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4205834..4206703
Genome map
AA seq 289 aa AA seqDB search
MPNTQSSLRLLFPQWQGGNNPPYFFGSRMLSWLAPPAQGVVEEVCVPEPGHAQLANEDGI
VGRRAIVEQLLDAQDKITRNQPETIVTLGGDCLVSLAPFAWLVEKYGDKLGVLWIDSHPD
VMTPEQFPHAHAHVLGALMGNGDAELTQVVRKPLSPGKALIAGIHSPLDVEKQFISERGI
ATLSPSELRQNPQAIDEWIARERIEYLAIHLDLDVLDPALFRAVLFARPGRGVHDFGDVA
EGKLTIAEVVNLINQAAAQAKPVGLTVAEHLPWDTLNLKNMLEALPLLS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgccaaatacccaatccagtctgcgtttgctttttccgcaatggcaaggcggcaacaat
ccgccctacttcttcggctcccggatgctgtcctggctggcgcctcctgcgcaaggcgtt
gtcgaggaggtctgtgtccccgaaccaggacacgctcaactggcaaatgaagatggaatt
gtcggccgccgggcgatcgttgaacagttgcttgatgcacaagacaaaatcactcgaaat
cagccagagaccattgtcaccttagggggcgattgcctggtctccctggctcctttcgcc
tggcttgtggaaaaatatggcgataaattgggggtattatggattgattctcacccggac
gttatgacgccagagcagttcccacatgctcatgcccacgttcttggggcgttaatgggc
aatggcgacgcggaattaacccaggtggtcagaaagccattatcaccaggcaaagcgctc
attgccgggatccatagcccgctcgatgtcgaaaaacagtttattagtgaacgcggcatc
gccaccttaagcccatcagagctgcgtcagaatccgcaggcgattgacgagtggatagcg
cgtgaacgtattgagtacctggccatccatctcgatcttgatgtcctcgacccggccctg
tttcgagcagtgctatttgctcgtccggggcgcggcgtacacgattttggcgatgtcgcc
gaagggaaactgacgattgccgaagtggttaatcttatcaatcaagccgccgctcaggcc
aaaccggtcggcctcaccgtcgccgaacacctgccctgggataccttaaacctgaagaat
atgctcgaagctctaccattattgagttaa

DBGET integrated database retrieval system