KEGG   Enterobacter aerogenes KCTC 2190: EAE_19760Help
Entry
EAE_19760         CDS       T01529                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EAE_19760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_19760
  Lipid metabolism
   00071 Fatty acid degradation
    EAE_19760
  Amino acid metabolism
   00350 Tyrosine metabolism
    EAE_19760
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EAE_19760
   00626 Naphthalene degradation
    EAE_19760
Enzymes [BR:eae01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EAE_19760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4237286..4238296
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQIDVTDKKLRPLEHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVEKVGPGVTSLKPGDRASVAWFFEGCGHCEYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAVDVNDGQLELAASMGADLTVNSRNEDAAKIIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLIEAFQFAAEG
KVVPKVTLRPLGDINAIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtagtcacccacgaccaccagattgatgtaaccgataaaaagttacgc
ccgctggagcatggcgaagcgctgctgaaaatggaatgctgcggggtctgccacactgac
ctgcacgtgaaaaacggcgatttcggcgataaaaccggcgtcattctcggccatgagggc
atcggcatcgtggaaaaagtcggccctggcgtgacgtcgctgaagccgggcgatcgcgcc
agtgtggcgtggttctttgaaggttgcggccactgcgaatactgtaacagcggcaacgaa
accctgtgccgctcggtgaaaaatgccggttataccgtcgatggcgggatggccgaagag
tgtatcgtcaccgccgattacgcggtcaaagtgccggatggactggattccgccgccgcc
agcagcatcacctgcgccggcgtcaccacctataaagcggtgaaggtctcacacatcaag
cccggccagtggattgccatttatggcctcggcggcctgggtaacctggcgctgcaatat
gccaaaaacgtctttaatgccaaagtgatcgccgttgacgtcaacgacgggcagctggag
cttgccgcctcgatgggcgccgacctgacggtaaattcccgcaacgaagacgccgccaaa
atcattcaggagaaaaccggcggcgcccacgcggccgtggttaccgccgttgctaaagcg
gcatttaactctgccgtggatgcggttcgcgccggcggccgcgtcgtcgccgttggccta
ccgccggaagccatgagcctcgatattcctcgtctggtgctggacgggattgaagtagta
ggttcgctggtaggtacccgtcaggatctgattgaagccttccagtttgccgccgaaggc
aaagtggtgccgaaagtcactctgcgcccgctcggcgatatcaacgccatctttaaggag
atggaacagggtcaaatccgcggccgtatggttatcgatttccgccgttaa

DBGET integrated database retrieval system