KEGG   Klebsiella aerogenes KCTC 2190: EAE_20490Help
Entry
EAE_20490         CDS       T01529                                 

Definition
(RefSeq) enoyl-CoA hydratase-isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00071  Fatty acid degradation
eae00280  Valine, leucine and isoleucine degradation
eae00281  Geraniol degradation
eae00310  Lysine degradation
eae00360  Phenylalanine metabolism
eae00362  Benzoate degradation
eae00380  Tryptophan metabolism
eae00410  beta-Alanine metabolism
eae00627  Aminobenzoate degradation
eae00640  Propanoate metabolism
eae00650  Butanoate metabolism
eae00903  Limonene and pinene degradation
eae00930  Caprolactam degradation
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01120  Microbial metabolism in diverse environments
eae01130  Biosynthesis of antibiotics
eae01212  Fatty acid metabolism
Module
eae_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EAE_20490
   00650 Butanoate metabolism
    EAE_20490
  Lipid metabolism
   00071 Fatty acid degradation
    EAE_20490
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAE_20490
   00310 Lysine degradation
    EAE_20490
   00360 Phenylalanine metabolism
    EAE_20490
   00380 Tryptophan metabolism
    EAE_20490
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAE_20490
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EAE_20490
   00281 Geraniol degradation
    EAE_20490
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EAE_20490
   00627 Aminobenzoate degradation
    EAE_20490
   00930 Caprolactam degradation
    EAE_20490
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EAE_20490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 10794322
NCBI-ProteinID: YP_004594284
UniProt: A0A0H3FTD8
Position
complement(4389994..4390761)
Genome map
AA seq 255 aa AA seqDB search
MSDLLIHRHGRALQLTLNRPQARNALNNALLTQIAEVLEAAAVDDSVGVCVISGNARFFA
AGADLNEMAEKDLPATLDDIRPRLWARIDAFTKPLIASVNGYALGAGCELALLCDLIVAG
DNARFGLPEITLGIMPGAGGTQRLIRSVGKALASRMVLSGESIDARQAQQAGLVSDIHPA
ALTDEYALKLATTIARHSPLALRAAKQSLRLSQEVSLQAGLQQERQLFSLLSATEDRREG
IDAFLQKRTPEFKGR
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacctgctgatccaccgtcatggccgggcgcttcagttgacgctgaaccgcccg
caggcccgcaacgcgctgaacaatgccttattaacccagattgccgaggtgctggaggcc
gcggcagttgatgacagcgtcggcgtctgcgttatcagcggtaacgcgcgttttttcgcc
gccggggctgacctcaatgaaatggcggaaaaagatctgcctgccacccttgatgatatt
cgcccacggttatgggcgcgaatcgatgcctttactaaaccgctcatcgcttcggtcaac
ggctacgcgctcggtgccggctgcgagctggctctgctgtgcgacctgattgtcgccggc
gacaacgcccgctttggcctgccggaaattaccctcggcattatgccgggcgctggcggc
acccagcggctgatccgcagcgttggcaaggcgctggccagccggatggtgctgagcggc
gagagtattgacgcccgccaggcgcaacaggccgggctggtcagcgatatccatccggcg
gctttaaccgatgagtatgccctgaaactggcaaccaccattgcccgccattcgccgctg
gcgctacgggcggcaaaacagtcgctgcgcctgtcgcaggaagtcagcctgcaggctggt
ctgcaacaggagcgccagctgtttagcctgctgagcgccaccgaggaccgccgcgaaggc
atcgacgccttcttacaaaaacgtacaccggaatttaaaggacgctaa

DBGET integrated database retrieval system