KEGG   Enterobacter aerogenes KCTC 2190: EAE_21430Help
Entry
EAE_21430         CDS       T01529                                 

Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAE_21430
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAE_21430
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAE_21430
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAE_21430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4591033..4592226
Genome map
AA seq 397 aa AA seqDB search
MSTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAEFTDLLKNYAGRPTALT
KCRNLTEGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YEKAHYMLGTAAGPHPFPTIVREFQRMIGEETKAQILEKEGRLPDAVIACVGGGSNAIGM
FADFIDESRVGLIGVEPAGHGIETGEHGAPLKHGRVGIYFGMKSPMMQTSDGQIEESYSI
SAGLDFPSVGPQHAFLNSTGRAEYVSITDNEALDAFKALSRHEGIIPALESSHALAHALK
MMRENPDKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttactgaacccgtatttcggcgaattcggcggtatgtacgttccgcagatc
ctgatgcccgccctgcgccagctggaagaagctttcgtcagcgcgcaaaaagatcctgag
tttcaggctgaattcaccgacctgctgaaaaactacgcgggtcgtccgacagcgctgacc
aaatgccgcaatctgaccgaaggcacccgcaccacgctgtacctcaagcgtgaagatctg
ctccacggcggcgcgcacaaaaccaaccaggtgctgggccaggcgctactcgccaaacgt
atgggcaaaacggaaattatcgccgaaaccggcgccggccaacacggcgtcgcctcggcg
ctggccagcgccctgctcggtctgaaatgccgcatctatatgggcgccaaagacgtcgag
cgccagtcgccgaacgtcttccgcatgcgcctgatgggtgcggaggtcattccagtgcac
agcggttccgccaccctgaaagatgcctgtaacgaagcgctgcgcgactggtccggcagc
tacgagaaggcgcactacatgctcggcactgccgctggcccgcatccattcccgactatc
gtgcgtgaattccagcgcatgatcggcgaagaaaccaaagcgcagatccttgagaaagaa
ggacgcctgccggacgcggtgatcgcctgcgttggcggtggttctaacgccatcggcatg
ttcgctgatttcattgatgaatcccgcgttggcctgattggcgtcgagcctgccggccac
ggtatcgaaaccggcgagcacggcgcgccgctgaagcacggtcgcgtcggcatttacttc
ggcatgaagtcgccgatgatgcaaacttccgacgggcagatcgaagaatcttattctatc
tccgccgggctggatttcccgtcagtgggtccgcagcatgcgttccttaacagcaccggg
cgcgccgagtatgtgtcaattaccgacaacgaagcgctggatgcctttaaagcgctctcc
cgccatgaaggcattattccggcgctggagtcgtcgcacgctctggcgcacgcgctgaag
atgatgcgcgagaatccggataaagagcagctgctggtggttaacctgtctggccgcggc
gataaagacatcttcaccgtacacgacattttgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system