KEGG   Enterobacter aerogenes KCTC 2190: EAE_21435Help
Entry
EAE_21435         CDS       T01529                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAE_21435 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAE_21435 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAE_21435 (trpA)
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAE_21435 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4592226..4593035
Genome map
AA seq 269 aa AA seqDB search
MERYETLFAQLKNRQEGAFVPFVTLGDPGPEQSLKIIDALIEAGADALELGIPFSDPLAD
GPTIQGATLRAFAAGVTPAQCFEMLAAIRHKHPTIPIGLLMYANLVFSPGIDEFYAECAR
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLIEKLAEYNAAPPLQGFGISAPEQVSAAIDAGAAGAISGSAIVKI
IERNLEQPQNMLAELKTFVRSLKAATKTA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgagacgctatttgcacagttaaaaaaccgccaggaaggcgcctttgtt
cccttcgtcaccctcggcgatccggggccggaacagtcgctgaaaatcatcgatgcgctg
attgaagccggcgccgatgcgctggaattggggatccccttctccgacccgctggccgac
ggcccgacgattcagggtgccacattgcgcgcttttgccgccggcgtcaccccggcgcag
tgcttcgaaatgctggcggcgatccgccacaagcatccgacaatcccaatcggccttttg
atgtacgcgaacctggtgttcagcccggggattgatgagttctacgccgaatgcgcgcgt
gtcggcgtggattcggttctggtcgccgacgtgccggtcgaagagtccgccccgttccgc
caggccgccctgcgtcataacattgcgccgattttcatctgcccgccaaatgccgatgac
gatttactgcgccagattgcctcctatggccgcggctatacctacctgctatcgcgcgct
ggcgtgacaggcgcggaaaaccgcgccgcgctgccgctacatcatctgattgaaaaactg
gcggaatataacgccgcgccgccgctgcagggctttggcatctcggcgccggagcaggtt
tccgccgccattgacgccggtgccgccggggcaatatccggctcggccatcgtcaagatt
atcgagcgcaatcttgagcagccgcagaacatgctcgcagagctaaaaaccttcgtgcgc
agtttgaaagcagcgaccaaaaccgcctga

DBGET integrated database retrieval system