KEGG   Klebsiella aerogenes KCTC 2190: EAE_21435Help
Entry
EAE_21435         CDS       T01529                                 

Gene name
trpA
Definition
(RefSeq) tryptophan synthase subunit alpha
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00260  Glycine, serine and threonine metabolism
eae00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eae01100  Metabolic pathways
eae01110  Biosynthesis of secondary metabolites
eae01130  Biosynthesis of antibiotics
eae01230  Biosynthesis of amino acids
Module
eae_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAE_21435 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAE_21435 (trpA)
Enzymes [BR:eae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAE_21435 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-GeneID: 10794507
NCBI-ProteinID: YP_004594469
UniProt: A0A0H3FTS6
Position
4592226..4593035
Genome map
AA seq 269 aa AA seqDB search
MERYETLFAQLKNRQEGAFVPFVTLGDPGPEQSLKIIDALIEAGADALELGIPFSDPLAD
GPTIQGATLRAFAAGVTPAQCFEMLAAIRHKHPTIPIGLLMYANLVFSPGIDEFYAECAR
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQIASYGRGYTYLLSRA
GVTGAENRAALPLHHLIEKLAEYNAAPPLQGFGISAPEQVSAAIDAGAAGAISGSAIVKI
IERNLEQPQNMLAELKTFVRSLKAATKTA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgttacgagacgctatttgcacagttaaaaaaccgccaggaaggcgcctttgtt
cccttcgtcaccctcggcgatccggggccggaacagtcgctgaaaatcatcgatgcgctg
attgaagccggcgccgatgcgctggaattggggatccccttctccgacccgctggccgac
ggcccgacgattcagggtgccacattgcgcgcttttgccgccggcgtcaccccggcgcag
tgcttcgaaatgctggcggcgatccgccacaagcatccgacaatcccaatcggccttttg
atgtacgcgaacctggtgttcagcccggggattgatgagttctacgccgaatgcgcgcgt
gtcggcgtggattcggttctggtcgccgacgtgccggtcgaagagtccgccccgttccgc
caggccgccctgcgtcataacattgcgccgattttcatctgcccgccaaatgccgatgac
gatttactgcgccagattgcctcctatggccgcggctatacctacctgctatcgcgcgct
ggcgtgacaggcgcggaaaaccgcgccgcgctgccgctacatcatctgattgaaaaactg
gcggaatataacgccgcgccgccgctgcagggctttggcatctcggcgccggagcaggtt
tccgccgccattgacgccggtgccgccggggcaatatccggctcggccatcgtcaagatt
atcgagcgcaatcttgagcagccgcagaacatgctcgcagagctaaaaaccttcgtgcgc
agtttgaaagcagcgaccaaaaccgcctga

DBGET integrated database retrieval system