KEGG   Enterobacter aerogenes KCTC 2190: EAE_21700Help
Entry
EAE_21700         CDS       T01529                                 

Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:eae00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4644056..4644697
Genome map
AA seq 213 aa AA seqDB search
MSHRALLLVDLQNDFCAGGALAVPEGDSTIDIANQLIDWSLARGDAIIASQDWHPANHGS
FASQHQAEPYAQGELDGLPQTFWPDHCVQHSDGAALHPLLKQQAINAVFHKGQNPVIDSY
SAFFDNGHRQKTELDGWLRAHGVTELNILGLATDYCVKFTVLDALDLGYTVNVITDGCRG
VNLQPQDSAVAFMEMAAAGATLYTLDDWLETQP
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgagccaccgcgcgctgctattggtagacctgcaaaacgatttctgcgctggcggcgca
ctcgccgtccccgaaggcgacagcaccattgatatcgcaaatcagctgatcgactggagc
ctggcgcgcggcgacgccatcatcgcaagccaggactggcatccggccaaccatggtagc
tttgccagtcagcatcaggcggaaccctatgcccagggcgagcttgatggcctgccgcag
actttctggcccgatcactgcgtgcagcatagcgatggcgccgcgctgcacccgctactc
aaacagcaggctattaacgccgtgtttcataaagggcaaaatccggtaatcgacagctac
agcgcgtttttcgacaacggtcaccggcagaaaaccgaactcgatggctggctgcgcgcg
cacggcgtgacggagctgaacattctcggtctcgcgacggattactgcgttaagtttacc
gtgcttgatgcgctggatttgggctacaccgtcaacgtgatcaccgacggctgtcgcggc
gtcaacctgcagccgcaggacagcgccgttgcctttatggaaatggccgccgccggagcc
acgctctacaccctcgacgactggctggaaacccagccctga

DBGET integrated database retrieval system