KEGG   Enterobacter aerogenes KCTC 2190: EAE_22025Help
Entry
EAE_22025         CDS       T01529                                 

Definition
Pseudouridine synthase
Orthology
K06177  
tRNA pseudouridine32 synthase / 23S rRNA pseudouridine746 synthase [EC:5.4.99.28 5.4.99.29]
Organism
eae  Enterobacter aerogenes KCTC 2190
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4713723..4714409
Genome map
AA seq 228 aa AA seqDB search
MSTVIDTFIAPPCSAQIKILYEDAHLLLIDKPSGLLSLSGKNPQNQDSVHHRLVRDFPGC
TLVHRLDFGTSGLMVVARNKTINAALCQQFSQRAVSKVYHALLCGHPEEDEGIIDAPIAK
DPALFPRMAISARNGKPARSRYQVLSREWLPIAGGSLAVTRVRLLPETGRTHQLRIHCQH
LGYPILGCDLYGGLVEHQASRLMLHASELHFHHPVSGKAIAARQPSPF
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgtcattgatacctttatcgccccaccttgttccgcgcagattaagatcctc
tacgaggacgcgcatttgttgttgatcgacaaacccagcggcctgctcagcctgtcgggt
aagaacccgcagaaccaggattcagttcatcatcgcctggtgcgagattttccgggatgc
acgctggtgcatcgactcgatttcgggacgtccgggctgatggtggtcgcacgtaacaaa
acgatcaacgccgcgctgtgtcagcagttcagccagcgggcggtaagcaaggtctatcac
gccctgttatgcggacatccagaggaagatgaagggattatagacgcgccgattgccaag
gatccggcgctgtttccgcgcatggcgattagcgcgcgtaatggtaaaccggcgcgctcg
cgctatcaggtgctatcacgggaatggttgccaatagccggtggttcgctggcggtaacg
cgcgtgcggctgctgccggaaaccggacgcacccatcagctacgcatccactgccagcat
ctcggctatccgattctcggctgcgatctctacggagggctggtggagcatcaggcctca
cgcctgatgctccacgccagtgaactgcattttcatcatccggtcagcggtaaagcgata
gcggcgcgccagcccagtcctttttga

DBGET integrated database retrieval system