KEGG   Enterobacter aerogenes KCTC 2190: EAE_22350Help
Entry
EAE_22350         CDS       T01529                                 

Definition
lysozyme-like protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
eae  Enterobacter aerogenes KCTC 2190
Brite
Enzymes [BR:eae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     EAE_22350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4773422..4773925)
Genome map
AA seq 167 aa AA seqDB search
MNPTLRNKLIGAIAGGSGAIAIASVMLGNADGLEGRRYYAYQDVVGVWTVCDGHTGTDIR
RGHRYTDKECDNLLKADLRKVANAIDPLIKVRIPGPTRAALYSFTYNVGLGAFASSTLLK
KLNSGDIPAACKELQRWTYAGGKQWKGLISRRDIERQVCEWGQKWAD
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgacgctcaggaataaactgattggcgccatcgccggcggttccggcgctatc
gcaatcgcttctgtcatgcttggaaatgctgatggactggaagggcgacgctattacgct
taccaggatgtggtcggcgtctggactgtttgcgatggccacaccggtaccgacattcgc
cgcggtcaccgctacaccgacaaagagtgcgacaacctgctcaaggcagatctgcgaaag
gtggcaaacgccatcgacccgctgatcaaggttcgcatccctgggcctacccgtgccgcg
ctttactccttcacttataacgttggccttggtgctttcgccagctccacactgctgaag
aagctgaactccggtgatataccggcggcctgcaaagaactgcagcgctggacatatgcc
ggtgggaagcagtggaagggactgatctctcgacgtgatatagagcgccaagtctgcgag
tggggccagaaatgggccgattaa

DBGET integrated database retrieval system