KEGG   Enterobacter aerogenes KCTC 2190: EAE_23050Help
Entry
EAE_23050         CDS       T01529                                 

Definition
D-cysteine desulfhydrase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Cysteine and methionine metabolism
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:eae00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4898593..4899579)
Genome map
AA seq 328 aa AA seqDB search
MSLQNLTRFPRLEFIGAPTPLEYLPRLSDHLGRDIFIKRDDVTPMAMGGNKLRKLEFLAA
DALREGADTLITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTRAENYLTNGNRLLLD
LFNTQVEMCDALTDPNAQLEELATRIEAQGYRPYVIPVGGSNALGALGYVESALEIAQQC
EGAVEISSVVVASGSAGTHAGLAVGLEQLMPNAELIGVTVSRSVADQLPKVVTLQQAVAN
SLELQAKAEITLWDDYFAPGYGTPNEEGMEAVKLLAQLEGILLDPVYTGKAMAGLIDGIN
QNRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtcactacaaaatttaacgcgttttccgcgcctggaatttattggcgcgccgacgccg
ctggaatatctaccacgcctgtccgatcatctcggacgggatatttttataaaacgcgat
gatgtcacccccatggcgatgggaggaaataaactgcgtaagctggagttcctcgccgcc
gatgcgctgcgcgagggagctgatacgctgatcaccgcaggggcgattcaatcgaaccat
gtgcgccagacggcagccgtggctgcgaaactgggactgcactgcgtcgcgttgttggaa
aatccgataggcacgcgtgctgaaaattatctgaccaacggtaatcgcctgctgctggat
ctgttcaatactcaggttgagatgtgtgatgcattgaccgatcccaacgcgcagcttgaa
gagctggcgacacgtattgaagctcagggataccgtccatatgtcattccggtcggcgga
tctaacgccctgggcgcgttaggttatgtcgaaagcgcactggaaatcgcccagcaatgt
gaaggcgcggtggagatctcttcggtagtggttgcctccggtagcgcgggtactcatgcc
gggttggcggtaggcctggaacagctgatgccaaatgcagaattaataggggtgaccgtg
tcacgtagcgttgccgaccagttgcctaaggtggtgacgctgcagcaggccgttgccaac
agtcttgagctgcaggccaaagcggagattaccttgtgggatgattattttgctcccgga
tacggtacgcccaatgaagaaggcatggaagcggtgaaactgctggcgcagctggaaggt
atcctgctggatccggtttataccggaaaggccatggccgggctgattgatggcattaat
cagaaccgctttaaggatgaggggccgattctgtttatccataccggtggcgcgcccgcg
ctgtttgcttatcatccgcacgtctaa

DBGET integrated database retrieval system