KEGG   Enterobacter aerogenes KCTC 2190: EAE_23375Help
Entry
EAE_23375         CDS       T01529                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:eae01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:eae00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4967949..4969253
Genome map
AA seq 434 aa AA seqDB search
MSFNTIIDWNSCSAAQQQQLLMRPAISASESISKTVAGILANVKENGDAALREYSAKFDK
TTVTALKVSDEEIAAAGARLSDELKQAMAVAVNNIETFHNAQQLQVVDVETQPGVRCQQL
TRPIASVGLYIPGGSAPLFSTVLMLATPARIAGCQEVVLCSPPPIADEILYAAQLCGVRN
IFNVGGAQAIAAMAFGTESVAKVAKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADGGATPDFVASDLLSQAEHGPDSQVILLTPDADMGSRVAAAVERQLAALPRAETARE
ALSASRIIVARDLAQCVEISNQYGPEHLIIQTRNARELVDGITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELTREGFAALAPTIEILAAAELLTAHK
NAVTLRVAALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaataccattatcgactggaatagctgcagcgccgcacaacagcaacaactc
ttaatgcgcccggcgatttcagcttccgagagcatcagcaaaacggtagccgggatcctc
gctaacgttaaagagaatggcgatgccgctttacgcgaatatagcgccaaattcgataaa
accaccgtcacggcgctgaaagtatctgacgaagaaattgccgctgccggcgcgcgtctc
agcgacgaactcaaacaagcgatggcggtagcggtcaacaatatcgagacctttcacaac
gcgcagcagttgcaggttgtcgatgttgaaacccagcccggcgtacgctgccagcagctt
acccgccctatcgcctccgtcggcttatatattccgggcggctcggcgccgctgttttca
acggtgctgatgctggcaacgccagcacgcattgccggctgtcaggaagtggtgttgtgt
tcgccgccgccgattgccgatgaaattctttatgcggcgcagctgtgcggcgtgcgtaat
atctttaacgtcggcggcgcgcaggctatcgcggcaatggccttcggcaccgaatcggtg
gcgaaagtcgctaaaatctttggccctggcaacgccttcgtcaccgaggccaagcgccag
gtcagccagcgccttgacggcgcggctatcgacatgcctgccggcccgtctgaagtactg
gtgattgccgacggcggcgcgacgccggatttcgtcgcctccgatttactctcccaggcg
gaacatggcccggattcccaggttatcctgctgacccccgacgccgacatgggctcccgg
gtcgccgctgcggttgaacgtcagctagcggccctgccgcgtgccgaaaccgcgcgtgaa
gcgctttccgccagccgtatcattgtcgctcgcgatctcgcgcaatgtgtagagatctca
aatcagtacggaccggagcacctgattatccagacccgcaacgcccgtgaactggttgac
ggcattaccagcgctggttcggtattcctcggcgactggtcgccagaatcggcaggtgat
tacgcctccggcaccaaccacgtgctgccgacctacggctacactgccacctgttccagc
ctcggtctggcggatttccaaaagcgcatgaccgtacaggagctgacgcgtgaaggcttc
gccgccctcgccccaactatcgagatcctggccgcagccgaactgctgaccgcccacaaa
aacgccgtgacgctacgcgtagccgcccttaaggagcaagcatga

DBGET integrated database retrieval system