KEGG   Enterobacter aerogenes KCTC 2190: EAE_23550Help
Entry
EAE_23550         CDS       T01529                                 

Definition
GalU regulator GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eae  Enterobacter aerogenes KCTC 2190
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAE_23550
   00052 Galactose metabolism
    EAE_23550
   00500 Starch and sucrose metabolism
    EAE_23550
   00520 Amino sugar and nucleotide sugar metabolism
    EAE_23550
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAE_23550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5006115..5007005)
Genome map
AA seq 296 aa AA seqDB search
MVSLKAIIPVAGLGMHMLPATKAIPKEMLPIVDKPMVQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQGQQLGLGHSILCARPA
VGNNPFVVVLPDIILDGASADPLRYNLAAMVARFNETGRSQVLAKRMPGDLSEYSVIQTK
DGLKVEGEIGRIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWEELERTEPGAWGRIQLTD
AIAALAKKQSVDAMLMTGESYDCGKKMGYMQAFVSYGLRNHKEGTKFRESIKKLLA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtttgaaagcaattattccggtagcagggttagggatgcatatgttgcctgcc
accaaagcgataccgaaagagatgctgccaatcgttgataagccgatggttcagtatatc
gtcgatgagattgtcgccgccggaatcaaagaaattgtgctggtcacccattcatctaag
aatgctgtagaaaaccattttgatacctcctatgagctggaagcgctactcgagcagcgt
gttaagcgtcaactattagccgaagttcaggcgatttgtccgccaggcgtaacgataatg
aacgttcgtcagggccagcaactgggcctggggcattctatcctctgtgcgcgcccggcc
gttggcaataatccgtttgttgtggtgttaccggatatcattcttgatggcgcaagcgcc
gatccgctacgttacaacctggcggcaatggtcgcgcgtttcaatgaaaccgggcgcagc
caggttctggccaaacgaatgcctggcgatctctcagaatattccgtcattcaaaccaaa
gatggcttgaaagtggaaggagagattggccgtattgttgaatttattgaaaaaccagac
gagccgcaaacgctcgactctgacttgatggccgtagggcgttatgtgctgtctgctgat
atctgggaagaactcgagcgtactgaacctggcgcctggggtcgtattcaattaacggac
gctattgcggcactggcaaagaaacagtctgtcgatgccatgttgatgaccggtgagagc
tacgactgcggcaaaaaaatgggttacatgcaggcttttgtgagttacggcttacgtaac
cataaagaagggaccaaattccgcgagagcatcaagaagctgctggcgtga

DBGET integrated database retrieval system