KEGG   Klebsiella aerogenes KCTC 2190: EAE_23550Help
Entry
EAE_23550         CDS       T01529                                 

Definition
(RefSeq) GalU regulator GalF
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00040  Pentose and glucuronate interconversions
eae00052  Galactose metabolism
eae00500  Starch and sucrose metabolism
eae00520  Amino sugar and nucleotide sugar metabolism
eae01100  Metabolic pathways
eae01130  Biosynthesis of antibiotics
Module
eae_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAE_23550
   00052 Galactose metabolism
    EAE_23550
   00500 Starch and sucrose metabolism
    EAE_23550
   00520 Amino sugar and nucleotide sugar metabolism
    EAE_23550
Enzymes [BR:eae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAE_23550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD
Motif
Other DBs
NCBI-GeneID: 10794932
NCBI-ProteinID: YP_004594886
UniProt: A0A0H3FYW7
Position
complement(5006115..5007005)
Genome map
AA seq 296 aa AA seqDB search
MVSLKAIIPVAGLGMHMLPATKAIPKEMLPIVDKPMVQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQAICPPGVTIMNVRQGQQLGLGHSILCARPA
VGNNPFVVVLPDIILDGASADPLRYNLAAMVARFNETGRSQVLAKRMPGDLSEYSVIQTK
DGLKVEGEIGRIVEFIEKPDEPQTLDSDLMAVGRYVLSADIWEELERTEPGAWGRIQLTD
AIAALAKKQSVDAMLMTGESYDCGKKMGYMQAFVSYGLRNHKEGTKFRESIKKLLA
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggtgagtttgaaagcaattattccggtagcagggttagggatgcatatgttgcctgcc
accaaagcgataccgaaagagatgctgccaatcgttgataagccgatggttcagtatatc
gtcgatgagattgtcgccgccggaatcaaagaaattgtgctggtcacccattcatctaag
aatgctgtagaaaaccattttgatacctcctatgagctggaagcgctactcgagcagcgt
gttaagcgtcaactattagccgaagttcaggcgatttgtccgccaggcgtaacgataatg
aacgttcgtcagggccagcaactgggcctggggcattctatcctctgtgcgcgcccggcc
gttggcaataatccgtttgttgtggtgttaccggatatcattcttgatggcgcaagcgcc
gatccgctacgttacaacctggcggcaatggtcgcgcgtttcaatgaaaccgggcgcagc
caggttctggccaaacgaatgcctggcgatctctcagaatattccgtcattcaaaccaaa
gatggcttgaaagtggaaggagagattggccgtattgttgaatttattgaaaaaccagac
gagccgcaaacgctcgactctgacttgatggccgtagggcgttatgtgctgtctgctgat
atctgggaagaactcgagcgtactgaacctggcgcctggggtcgtattcaattaacggac
gctattgcggcactggcaaagaaacagtctgtcgatgccatgttgatgaccggtgagagc
tacgactgcggcaaaaaaatgggttacatgcaggcttttgtgagttacggcttacgtaac
cataaagaagggaccaaattccgcgagagcatcaagaagctgctggcgtga

DBGET integrated database retrieval system