KEGG   Klebsiella aerogenes KCTC 2190: EAE_23855Help
Entry
EAE_23855         CDS       T01529                                 

Definition
(RefSeq) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eae  Klebsiella aerogenes KCTC 2190
Pathway
eae00010  Glycolysis / Gluconeogenesis
eae00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:eae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAE_23855
   00500 Starch and sucrose metabolism
    EAE_23855
Enzymes [BR:eae01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     EAE_23855
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038
Motif
Other DBs
NCBI-GeneID: 10794991
NCBI-ProteinID: YP_004594945
UniProt: A0A0H3FYR6
Position
complement(5077545..5078939)
Genome map
AA seq 464 aa AA seqDB search
MKTFPQGFLWGGATAANQVEGAYLEDGKGLSTSDVQPQGVFGDVVERVAGDSGIKDVAID
FYHRYPQDIALFAEMGFNCLRVSIAWTRIFPNGDDAEPNEAGLAFYDKLFAEMAAHNITP
LVTLSHYEMPWALVKNYGGWGSRKVIGFFERYAKTVFSRYKNQVKLWLTFNEINMSLHAP
MTGVGLRAGSSKGEVYQAIHHQLVASALAVKACHELVPQGKIGNMLLGGLMYPLSCKPED
VFETLQQNRSWQFFGDVQCRGAYPGYMQRYFRENDITLTITDGDREALKETVDFISFSYY
MTGCVTADEALNQQARGNILSMVPNPHLASSEWGWQIDPLGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKIEADGSINDDYRISYLNDHLVQAREAIADGVELMGFTSWGPIDLVSASKAE
MSKRYGFIYVDRDDRGQGTLERRKKKSFAWYQAVIASNGGSLQE
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacattcccacagggctttttatggggcggcgccaccgcggcaaatcaggtcgaa
ggggcgtatctggaagatggcaaaggtttatccacctccgacgtgcagccgcagggggta
ttcggcgacgtcgtggagcgcgttgcgggcgacagcggtattaaagatgtggcgatcgat
ttttaccatcgttacccgcaggatatcgcgctgttcgctgagatgggcttcaactgtctg
cgggtatcgatcgcctggacgcgtatcttcccgaacggtgatgacgccgagccgaacgaa
gccgggctggccttctacgacaagctgtttgccgagatggccgcgcataatatcactccg
ctggtgacgctatcgcactatgagatgccgtgggcgctggtaaaaaactatggcggctgg
ggcagtcgcaaggtgattggctttttcgaacgctacgccaaaacggtattcagccgctat
aaaaatcaggtcaaactgtggctcacctttaacgaaattaatatgtcgctacatgcgcca
atgaccggcgtcgggctgcgggccggtagcagtaaaggcgaagtctatcaggctatccac
caccaactggtggccagcgcgctggcggtcaaagcctgtcatgaactggtaccgcaaggg
aaaattggcaatatgctgctcggcgggttgatgtatccgctgagctgcaagccggaagat
gtctttgaaacgctgcagcaaaaccgcagctggcagttcttcggcgatgtgcagtgccgt
ggtgcctatccgggatacatgcagcgctatttccgcgaaaacgatattacgctgaccatc
accgacggcgaccgggaagcgctgaaagagaccgtcgattttatctcctttagctactat
atgaccggctgcgtcaccgccgatgaagcgctgaaccagcaggcgcgcggtaacattctc
agcatggtgccgaatccgcatctggcaagctcggagtggggctggcagatagacccgctg
gggctgcgtaccctgttgaacgtactgtgggaccgctatcagaagccgttgtttatcgtt
gaaaatggtctgggggcgaaagataaaatcgaagccgacggcagcatcaacgatgactat
cgcatcagctatctcaacgatcatctggtgcaggcgcgcgaagccattgctgacggcgtt
gaactgatgggctttaccagttgggggccaatcgatctggttagcgcgtcgaaggccgag
atgtccaagcgctacggttttatctatgtcgatcgtgacgatcgcgggcaggggacgctt
gaacggcgtaagaagaaaagcttcgcctggtatcaggcggtgattgccagtaacggcggt
agcctgcaggaataa

DBGET integrated database retrieval system