KEGG   Erwinia amylovora CFBP1430: EAMY_0197Help
Entry
EAMY_0197         CDS       T01197                                 

Gene name
pldA3
Definition
(GenBank) Outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00564  Glycerophospholipid metabolism
eam00565  Ether lipid metabolism
eam00590  Arachidonic acid metabolism
eam00592  alpha-Linolenic acid metabolism
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAMY_0197 (pldA3)
   00565 Ether lipid metabolism
    EAMY_0197 (pldA3)
   00590 Arachidonic acid metabolism
    EAMY_0197 (pldA3)
   00591 Linoleic acid metabolism
    EAMY_0197 (pldA3)
   00592 alpha-Linolenic acid metabolism
    EAMY_0197 (pldA3)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     EAMY_0197 (pldA3)
    3.1.1.32  phospholipase A1
     EAMY_0197 (pldA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: CBA19139
UniProt: D4HUL6
Position
233766..234644
Genome map
AA seq 292 aa AA seqDB search
MALLKGLSATTLLLPTLVMAQEASIKEVHDSTAVPGSIIANLLEKHDNPFVMYPYESNYL
LYTDTSNLNKEAIQSYSWSDKAKHDEVKFQLSLAFPLWRGIVGDNSVLAASYTQKSWWQL
SNRGASSPFRETDYEPQIFLGWATDYRFAGWTLRDVETGFNHQSNGRSEPTSRSWNRVYA
RLMAENGHWLVEVKPWYRIPESENNDDNPDITRYMGYYRLTVGYQWGDSIFSLKSNYNWN
SGYGGAELGWSYPLTEHVRFYTQVFSGYGESLIDYNHRQTRVGVGVTLNDLF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgaaaggattgtcggcaacaacattgcttttgccgacgttagtaatggca
caggaagcctcgatcaaagaggtgcatgacagtaccgcagtgcctggcagtattatcgcc
aacctgttggaaaaacatgacaaccccttcgtgatgtatccttacgaaagtaattatctg
ctgtataccgataccagcaatctgaataaggaagcgatccagtcctacagctggagcgat
aaagctaagcacgatgaggtgaaatttcaactgagcctggctttcccgctgtggcgcggt
attgttggcgataactcggtgctggccgcttcctatacccagaaatcctggtggcagctt
tctaatcgcggtgcatcttcaccgttccgcgaaaccgattatgaaccgcagatcttcctt
ggctgggccacggattaccggtttgccggctggacattacgtgatgtcgaaaccggtttc
aatcatcagtctaacggccgttctgaaccgacctcacgcagctggaaccgggtctatgcg
cgtctgatggctgaaaacggtcactggctggtggaagtcaaaccctggtaccgtattcca
gaaagtgaaaataatgatgataacccggatatcaccaggtacatggggtattatcgcctg
acggtgggctaccagtggggtgacagtatcttcagcctgaagagcaactacaactggaac
agcggctacggcggtgccgagctgggctggagctatcccctgactgagcatgtgcgcttt
tacacccaggtgttcagcgggtacggggagtctctgatcgactacaaccatcgccaaacg
cgcgttggtgtcggcgtaacgctcaacgacctgttctga

DBGET integrated database retrieval system