KEGG   Erwinia amylovora CFBP1430: EAMY_0197Help
Entry
EAMY_0197         CDS       T01197                                 

Gene name
pldA3
Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:eam00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:eam00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:eam00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:eam00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
233766..234644
Genome map
AA seq 292 aa AA seqDB search
MALLKGLSATTLLLPTLVMAQEASIKEVHDSTAVPGSIIANLLEKHDNPFVMYPYESNYL
LYTDTSNLNKEAIQSYSWSDKAKHDEVKFQLSLAFPLWRGIVGDNSVLAASYTQKSWWQL
SNRGASSPFRETDYEPQIFLGWATDYRFAGWTLRDVETGFNHQSNGRSEPTSRSWNRVYA
RLMAENGHWLVEVKPWYRIPESENNDDNPDITRYMGYYRLTVGYQWGDSIFSLKSNYNWN
SGYGGAELGWSYPLTEHVRFYTQVFSGYGESLIDYNHRQTRVGVGVTLNDLF
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggctctgctgaaaggattgtcggcaacaacattgcttttgccgacgttagtaatggca
caggaagcctcgatcaaagaggtgcatgacagtaccgcagtgcctggcagtattatcgcc
aacctgttggaaaaacatgacaaccccttcgtgatgtatccttacgaaagtaattatctg
ctgtataccgataccagcaatctgaataaggaagcgatccagtcctacagctggagcgat
aaagctaagcacgatgaggtgaaatttcaactgagcctggctttcccgctgtggcgcggt
attgttggcgataactcggtgctggccgcttcctatacccagaaatcctggtggcagctt
tctaatcgcggtgcatcttcaccgttccgcgaaaccgattatgaaccgcagatcttcctt
ggctgggccacggattaccggtttgccggctggacattacgtgatgtcgaaaccggtttc
aatcatcagtctaacggccgttctgaaccgacctcacgcagctggaaccgggtctatgcg
cgtctgatggctgaaaacggtcactggctggtggaagtcaaaccctggtaccgtattcca
gaaagtgaaaataatgatgataacccggatatcaccaggtacatggggtattatcgcctg
acggtgggctaccagtggggtgacagtatcttcagcctgaagagcaactacaactggaac
agcggctacggcggtgccgagctgggctggagctatcccctgactgagcatgtgcgcttt
tacacccaggtgttcagcgggtacggggagtctctgatcgactacaaccatcgccaaacg
cgcgttggtgtcggcgtaacgctcaacgacctgttctga

DBGET integrated database retrieval system