KEGG   Erwinia amylovora CFBP1430: EAMY_0200Help
Entry
EAMY_0200         CDS       T01197                                 

Gene name
pldB3
Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    EAMY_0200 (pldB3)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     EAMY_0200 (pldB3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
237334..238326
Genome map
AA seq 330 aa AA seqDB search
MKLHQKSWLTREKAFAAFATGPLLDFWRQREEGEFSGVDNVPIRYVRFISSQHDKVILLC
PGRIESYVKYPELAYDLFHSGYDVFIIDHRGQGRSGRLLKDSHRGHVVAFEDYVEDLETL
YLQEIATRHYRHRYALAHSMGGAILALMLARQPAAFDAVALSSPMFGIFLPLPLWMARRI
LNWAEKRPTVRDDYALGTGKWRARPFAINDLTHSRERYRRNVRFYADDPGIRVGGPTYHW
VREGVRAGQRVLRQAAQISTPLLLLQAANDKVVDNRAQDLFCQMMVAAGQPCQGGKPMII
EGARHEILFEQDRMRAAALEAVLAFFARHA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaaactacaccagaaaagctggttaacgcgtgaaaaagccttcgcggcttttgccacc
ggcccgttgctggatttctggaggcagcgcgaagagggcgagttttcaggagtggataac
gtaccgatccgctacgtccgcttcatctcatcgcaacatgacaaggtgatattactgtgt
ccggggcgcattgaaagctatgtcaaatacccggagctggcctacgacctgtttcatagc
ggatatgacgttttcattatcgatcatcgcgggcaggggcgttcgggcagactgctaaag
gattcgcatcgtgggcacgttgtggcgtttgaagactacgttgaggatctggaaacgctg
tatttacaggagatcgccacacgccactatcgccatcgctatgcgctggcgcattcaatg
ggcggggcgatcctcgccctgatgttggcacgacagcctgcagcctttgacgcggtggcg
ctgtcttcaccgatgtttggcattttcctgcctttgccattatggatggcgcgccgcatt
ctcaactgggcggaaaaacgcccgacggtacgcgatgattatgcgctgggtaccgggaag
tggcgtgcgcgcccgtttgcgataaacgatctgacgcatagccgcgaacgctatcgccgc
aatgtgcgtttttatgctgacgatcccggtatacgcgttggtggcccgacctatcactgg
gtgcgggaaggcgtgcgggccgggcaacgcgttttgcgccaggccgcacagatttccacc
ccgctgctgctgctgcaggccgctaacgataaggtggtcgacaaccgtgctcaggacctg
ttctgccagatgatggtggccgcgggtcagccctgtcagggggggaagccgatgattatc
gagggtgcgcgccatgagatcctgtttgagcaagaccggatgcgcgcagcggcgcttgaa
gccgtcctcgccttttttgcccgccatgcctga

DBGET integrated database retrieval system