KEGG   Erwinia amylovora CFBP1430: EAMY_0223Help
Entry
EAMY_0223         CDS       T01197                                 

Gene name
fadB
Definition
fatty acid oxidation complex subunit alpha FadB
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAMY_0223 (fadB)
   01212 Fatty acid metabolism
    EAMY_0223 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EAMY_0223 (fadB)
   00650 Butanoate metabolism
    EAMY_0223 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    EAMY_0223 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    EAMY_0223 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAMY_0223 (fadB)
   00310 Lysine degradation
    EAMY_0223 (fadB)
   00380 Tryptophan metabolism
    EAMY_0223 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAMY_0223 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EAMY_0223 (fadB)
   00281 Geraniol degradation
    EAMY_0223 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    EAMY_0223 (fadB)
Enzymes [BR:eam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EAMY_0223 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EAMY_0223 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EAMY_0223 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     EAMY_0223 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(258586..260772)
Genome map
AA seq 728 aa AA seqDB search
MLYQGATLSLDWLEDGIAELVFDAPGSVNKLDTQTVTSLGEAITTLEQQPGLRGVLLSSR
KSAFIVGADIMAFLSLFAAPAEQLAQWLAFANGVFNRLEDLPVPTVAAINGYALGGGCEC
VLATDFRIASADTRIGLPETKLGIIPGFGGSVRMPRLLGADSALDIIAGGKDIDAAQALK
VGLVDAVVSVDKLHAAALSVLKEAIAGRLPWRERRQIKLEPLKLSNIEAAMSFSTAEAMV
LQTAGKHYPAPLTVVQTIEAAAGSGRDEAQKLETAAFVPLARSDEARALVGIFLNDQMVK
AKVKKQIKDVAAPERAAVLGAGIMGGGIAYQSACKGVPIMMKDISEKALTLGIGEAAKLL
NKQLMRGKIDGLKLAGIISTIQPVLHYAGFDRVDVVVEAVVENPQVKAEVLAEAEHHIRP
DAILASNTSTIPIDQLAEALTRPENFCGMHFFNPVPRMPLVEVIRGSKTSDATIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSLLLRDGADFRQIDKVMEKQFGWPMGPSWL
LDVVGIDTAHHAQSVMAVGFPSRMNKDYRDAVDVLFAAKRYGQKNQQGFWRWETDSKGKL
QKVSDSETDDLLQSVCQPKRVFSDEDIVARMMIPMINEVVRCLDEGVIASPAEADMALVY
GLGFPPFHGGAFRYLDTVSNDRYIARAEPFSALGPLYQVPASLREKATQGASWYSTATPP
DETKLKTA
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaggcgcaaccctttccctcgactggctggaagacggcatagccgaactg
gtttttgatgcccccggctcggtgaataagcttgatacgcagaccgttaccagcctgggc
gaagccatcacaacgcttgaacagcagccaggattgcgcggagtgctgcttagctcgcgc
aaatcggcgtttatcgtcggtgccgatattatggcgtttttgtccctgtttgccgcacca
gcggaacagctggctcagtggctggcgtttgccaacggcgtctttaaccggcttgaggat
ctgccggtgcctaccgttgcggccattaatggctacgcgctgggcggcggttgtgagtgt
gtgctcgctaccgattttcgtattgccagcgcagatacgcgcatcgggctgccggaaacc
aaattaggcattatacccggttttggcggatcggtgcgtatgccgcgcctgctgggcgct
gacagtgcgctggatattatcgccggcggaaaggacattgatgccgcacaggcactgaag
gttggcctggtggatgccgttgtgtctgtggataaactccacgcggcagcactttccgtg
ctgaaagaagccatagcgggcagattaccctggcgtgaacgtcggcagatcaaactggaa
ccgctgaaactaagcaacatcgaggcagcaatgagtttcagcaccgccgaagcgatggtg
ctgcaaacggccggcaagcactacccggcaccgcttaccgtggtgcaaaccattgaggca
gcggcaggatcaggccgcgatgaagcccagaaactggagacggctgcctttgtgccgctg
gcgcgctctgatgaagcccgcgcgctggttggcatctttcttaatgaccagatggtgaaa
gctaaagttaaaaaacagataaaagacgtcgcagcccctgagcgtgctgccgtattaggt
gccggcatcatgggcggcggcattgcttatcaatctgcctgcaaaggcgtgccgatcatg
atgaaggacattagcgaaaaagcactgacgctggggattggtgaagcggcgaagctgctt
aataagcagttgatgcgtggcaagattgacggcctgaagctggccggcatcataagtacg
atccagccagtgcttcactatgctggctttgatcgcgtcgacgtggtggtcgaagcggtg
gtggagaacccacaggtgaaagccgaagtgctggcggaagccgagcatcatatccgtccg
gatgccattctcgcatcgaatacctcaaccattccaatcgaccagctcgctgaagcatta
acccgcccggaaaatttctgcggcatgcactttttcaatccggtaccgcgtatgccgctg
gtggaggtgattcgcggcagcaaaacgtcagatgccaccatcgccaaagtggtggcctgg
gccagcaaaatgggcaaaacgccgattgtggtcaatgactgccccggcttctttgttaac
cgcgtgttgttcccttacttcgccggtttcagcctgttactgcgcgatggtgccgacttc
cgccaaatcgacaaagtgatggaaaaacagtttggctggccgatgggcccttcgtggctg
ctggacgtggtgggcattgataccgcacatcatgcacaaagcgtgatggcagtcgggttc
ccgtcgcggatgaacaaggattatcgcgacgccgttgatgtgctgtttgcggcgaaacgc
tacgggcagaaaaaccagcagggcttctggcgctgggaaaccgacagcaagggcaagctg
cagaaagtctccgacagcgaaaccgatgatctgctgcaaagcgtctgccagccaaaacgt
gttttcagcgatgaagatatcgtggcgcgcatgatgataccgatgatcaacgaagtggtg
cgatgtctggatgaaggcgtgatcgccagcccggcagaggccgatatggcgctggtttat
ggtctcggtttcccaccattccacggcggtgctttccgctatctggacaccgtaagcaac
gatcgctatatcgcgcgcgccgagccgttcagcgcgctaggcccgctctatcaggtgccg
gcaagtttacgtgaaaaggcaactcaaggcgcgagttggtattccacggcgactccgccg
gatgagacaaaattaaaaacggcgtga

DBGET integrated database retrieval system