KEGG   Erwinia amylovora CFBP1430: EAMY_0343Help
Entry
EAMY_0343         CDS       T01197                                 

Gene name
folP
Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eam00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
398586..399422
Genome map
AA seq 278 aa AA seqDB search
MKLFARDAVLDLSHPHVMGILNVTPDSFSDGGKHNELIHALTHANEMINAGATIIDVGGE
STRPGAAEVSTEQELDRVIPVVEAIAQRFEVWISVDTSKPEVIHEAARAGAHIINDVRSL
HQPGALAAAAQTGLPVCLMHMQGEPKTMQQSPRYQNVLHDVEAFFVENIARCEAAGIKKS
QLLLDPGFGFGKNLSHNYQLLAHLADLHHFGLPLLVGMSRKSMIGQLLNVGPSQRLTGSL
ACAVIAAMQGAHILRVHDVKETVEAMRVVEATQSAREK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgttcgccagagatgccgtgctcgatctctctcatccccatgtgatggggatt
ttgaatgtcactcccgactctttttctgatggcggcaagcataacgaattaattcatgca
ctaacccacgcaaacgagatgattaacgccggcgcaacgattatcgatgtcggcggagag
tccacccgtcccggtgccgcagaggtcagcacggagcaggagctggatcgcgttatcccg
gtggtggaagccatcgctcaacgttttgaagtatggatctcggtcgatacttccaagcca
gaggtgatccacgaagctgcacgggcaggggcacacatcatcaacgatgtacgctcacta
catcaacctggcgcgctggccgctgctgcgcaaacgggtttgccggtgtgcctgatgcat
atgcagggcgaaccaaaaaccatgcagcagtcgccacggtatcagaacgttctgcacgat
gttgaggctttttttgtcgagaatattgcccgctgcgaagcggctgggatcaaaaaatcg
cagttgctgctcgacccgggttttggtttcggtaagaatctctcccacaactatcaactg
ctggcgcatctggccgatttacatcattttggcctgccgctgctggtcggtatgtcgcgt
aaaagtatgattggtcagctactgaacgtggggccatcgcaaagattgaccggtagcctc
gcctgcgcggtgattgccgcgatgcagggcgcccatattctgcgcgtacacgacgtcaaa
gaaaccgtagaggcgatgcgcgttgtcgaagccacacagtccgcaagggaaaaataa

DBGET integrated database retrieval system