KEGG   Erwinia amylovora CFBP1430: EAMY_0607Help
Entry
EAMY_0607         CDS       T01197                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    EAMY_0607 (speB)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     EAMY_0607 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683095..684018
Genome map
AA seq 307 aa AA seqDB search
MNNTLNHEYDNSLVSNAFGFMRFPLNFRPYDSDAEWVITGVPFDAATSGRPGSRLGPGAI
RQISTNLAWEGCRWPWSFDLRQQLKVIDCGDLVYAFGDAQDFSDKLQAHAEKLLAKGKRM
LTFGGDHYISLPLLRAHAKTFGKMALVHFDAHTDTYSNGPTFDHGTMFYTAPKEGLISPE
HSVQIGIRTEFNPSLGFNVLDAAQVNDRSVDDILAQVKQIVGDLPVYLTFDIDCLDPAHA
PGTGTPVIGGLTSDKASKLIRGLQGMNIVGMDLVEVAPGYDQSDITALAAASLALDMLYV
QAANKIK
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacaccctaaaccacgagtacgacaactccctggtatcaaacgcttttggcttt
atgcgtttcccgcttaacttccggccgtacgacagcgatgccgagtgggtgatcaccggc
gtgccttttgatgcagcgacctctggccgccccggcagccgtcttggccccggcgctatt
cggcagatttccaccaatctggcgtgggaaggctgccgctggccgtggtcgttcgatttg
cgccagcagctgaaggtgattgattgtggggatctggtttatgcctttggagacgcacaa
gatttcagcgacaaattgcaggcgcacgctgaaaagctgctggcgaaggggaaacgcatg
ctgacctttggcggcgaccactacatcagtttgccgctgctgcgcgcgcacgcgaaaacc
ttcggtaagatggcgctggtgcattttgacgcgcatacagatacctactcaaatggccca
accttcgatcacggcaccatgttttataccgcgccgaaagaaggtttgatctctcctgag
cactcggtgcagattggtattcgcaccgaattcaacccgtctctgggctttaacgtgttg
gatgcggcgcaggttaacgatcgcagcgtggacgatatcctggcgcaggtgaaacagatt
gtcggtgacctgcccgtctatctgacctttgatattgactgcctcgaccctgcccacgca
ccgggtaccggcacgccggtgatcggtggcctgaccagcgataaagccagcaagttaatc
cgtggtctgcagggcatgaatatcgtagggatggatctggttgaagtggccccaggctac
gaccagtctgatattaccgcgctggcggctgccagcctggcgttggatatgctgtacgtg
caggctgccaacaagatcaaataa

DBGET integrated database retrieval system