KEGG   Erwinia amylovora CFBP1430: EAMY_0655Help
Entry
EAMY_0655         CDS       T01197                                 

Gene name
dsbC
Definition
protein disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
eam  Erwinia amylovora CFBP1430
Brite
Enzymes [BR:eam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     EAMY_0655 (dsbC)
Secretion system [BR:eam02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   EAMY_0655 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
728599..729303
Genome map
AA seq 234 aa AA seqDB search
MKKHYLLLSVLLAAVSGLANADDASIRQSLSKLGLQQTEIQPSPLAGFKTVLSESGVLYV
TDDGKHFIQGPLYDVSGSHPVNVTNKLLEKKVEALSKEMIVYKAPKEQYVVTVFTDITCG
YCHKLHQQMADYNALGITVRYLAFPREGMEGPVAKKMKSIWCAADRNKALDAAMKGDEVK
AADCKIDLSQHYTLGAQYGIQGTPAMLLQDGTLVPGYQGAQELKKFLDGQKNGG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagcattacctgttactttcagtattattagccgcagtcagtggactggcaaac
gctgatgatgcatctatccggcagtcgttaagcaaactgggcttacaacagactgagatc
caaccttcgccactggcgggatttaaaaccgtgctaagcgaaagcggtgtactgtacgtc
accgacgacggcaaacattttattcaggggccgctctatgatgtcagcggcagccatccg
gttaacgtcaccaacaagctgctggaaaagaaagtggaagcgctaagcaaagagatgatc
gtctacaaagcgccgaaagagcagtacgtggtcacggtgtttaccgatatcacctgtggc
tactgtcataaactgcatcagcagatggcggactacaatgctctggggatcaccgtgcgc
tatctggccttcccgcgtgaagggatggaaggcccggtggcgaaaaagatgaaatccatc
tggtgtgccgccgaccgtaacaaggcgcttgatgcggcgatgaaaggtgatgaggtgaaa
gcggctgactgtaagattgacctgtcacagcattatacactgggcgcccagtacggtatt
cagggtactccggctatgctgttgcaggacggcacgctggtgcctggctatcagggagcg
caggaactgaagaaattccttgacggccagaaaaatggtggctga

  All links  
No link information was found.   
DBGET integrated database retrieval system