KEGG   Erwinia amylovora CFBP1430: EAMY_0875Help
Entry
EAMY_0875         CDS       T01197                                 

Definition
(GenBank) dioxygenase
  KO
K08967  1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00270  Cysteine and methionine metabolism
eam01100  Metabolic pathways
Module
eam_M00034  Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    EAMY_0875
Enzymes [BR:eam01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     EAMY_0875
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     EAMY_0875
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ARD Cupin_2 AraC_binding
Motif
Other DBs
NCBI-ProteinID: CBA19825
UniProt: D4HXD4
Position
960324..960866
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTESEATTPVWYSIDAAEIADKLRSKGVRFERWHADRDLGDNPDPETVIGAYQH
AIDRLVAEKGYQSWDVISMRADNPQKEALRSKFLSEHTHGEDEVRFFVEGAGLFCLHLDG
HIFQILCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDNQEGWIAKFTGDPIADGYPRLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgactatttttaccgaaagcgaagcaaccaccccggtgtggtacagcatc
gatgcggctgagatcgctgataagctgcgcagtaaaggcgtgcgctttgaacgctggcat
gccgaccgtgacctcggagataatcccgatcccgaaacggtgatcggcgcttatcagcat
gccatcgaccggctggtggcggagaaaggctatcaaagctgggacgtgatcagcatgcgt
gccgataacccgcaaaaggaggcgctgcgcagcaagtttctctctgaacatacccacggt
gaagatgaagtacgcttctttgtcgaaggggcggggctgttctgcctgcatcttgacggg
catatttttcagatcctgtgcgaaaaaaacgatctgatctcggttccggccgggacgccg
cactggtttgatatgggatcgtcaccgcatttcaccgccatccgcatcttcgacaatcag
gaaggctggatcgccaaatttaccggcgatccgattgcggacggctacccgcgcctgcct
taa

DBGET integrated database retrieval system