KEGG   Erwinia amylovora CFBP1430: EAMY_0875Help
Entry
EAMY_0875         CDS       T01197                                 

Definition
dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:eam00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
960324..960866
Genome map
AA seq 180 aa AA seqDB search
MSALTIFTESEATTPVWYSIDAAEIADKLRSKGVRFERWHADRDLGDNPDPETVIGAYQH
AIDRLVAEKGYQSWDVISMRADNPQKEALRSKFLSEHTHGEDEVRFFVEGAGLFCLHLDG
HIFQILCEKNDLISVPAGTPHWFDMGSSPHFTAIRIFDNQEGWIAKFTGDPIADGYPRLP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcactgactatttttaccgaaagcgaagcaaccaccccggtgtggtacagcatc
gatgcggctgagatcgctgataagctgcgcagtaaaggcgtgcgctttgaacgctggcat
gccgaccgtgacctcggagataatcccgatcccgaaacggtgatcggcgcttatcagcat
gccatcgaccggctggtggcggagaaaggctatcaaagctgggacgtgatcagcatgcgt
gccgataacccgcaaaaggaggcgctgcgcagcaagtttctctctgaacatacccacggt
gaagatgaagtacgcttctttgtcgaaggggcggggctgttctgcctgcatcttgacggg
catatttttcagatcctgtgcgaaaaaaacgatctgatctcggttccggccgggacgccg
cactggtttgatatgggatcgtcaccgcatttcaccgccatccgcatcttcgacaatcag
gaaggctggatcgccaaatttaccggcgatccgattgcggacggctacccgcgcctgcct
taa

DBGET integrated database retrieval system