KEGG   Erwinia amylovora CFBP1430: EAMY_0912Help
Entry
EAMY_0912         CDS       T01197                                 

Gene name
lacZ3
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    EAMY_0912 (lacZ3)
  Lipid metabolism
   00600 Sphingolipid metabolism
    EAMY_0912 (lacZ3)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    EAMY_0912 (lacZ3)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     EAMY_0912 (lacZ3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(992768..995848)
Genome map
AA seq 1026 aa AA seqDB search
MASRDPLTLQQLLSQRHWENPALTQLNRLPTHTPLASWRSEDAARSDLPSPSIRELDGEW
GFNYFHRPQAVPDEWLYHDLPQVGSIAVPSNWQLAGYDAPIYTNVQYPIPVAPPRVPEDN
PTGCYSLNFRCPPDWLQSGQTRIIFDGVNPAFYLWCNGEFIGYSQDSRLPAEFDLSHSLR
AEENRIAVMVLRWCDGSYLEDQDMWRMSGIFRSVSLLHKPVVRLNDIQTDTRLSPELRSA
RLQVMALCSLPDASAWRLEVKLWHEDTLIAQQQQPFGTPVVDERGSYLDRTRLSLHIDQP
LLWSAETPHLYRAVVTLLDADGRLVEAEACDVGFRQIEVSGGLLKLNGKALLIRGTNRHE
HHPHRGQVMDEPAMVTDILLMKQHNFNAVRCSHYPNHPLWYRLCDRYGLYVVDEANIETH
GMQPMNRLADDPVWFQAFSERVIRMVQRDRNHACIIIWSLGNESGHGSTHDALYRWVKSN
DPGRPVQYEGGGADSAASDIICPMYARVDQDQPFAAVPKWSIKKWIGLPEETRPLILCEY
AHAMGNSLGGFERYWRAFRQFPRLQGGFIWDWADQSLTRHDADGSSWQAYGGDFGDTPND
RQFCMNGLLFADRSPHPALFEAQRAQQFFQFALVSTAPIIVSITSEYLFRHSDNEQLCWR
IEHQGKGVAEGQITLDLPPEGTLCLTLGELPSLTGELWLRVSVIQPTATAWSAAGHRVAW
DGWRLPAALALPQPQMTGELPRLHQQPQLIEIVHGQQRWHFCRQSGELIQWLQANEPQLL
SPLRDLFVRAPLDNDIGISQASCIDPNAWVERWQRAGYFQLESRLLSLQTDILSDGVQIR
SEQAWLTGTALRFLSRKCYRINLQGEVLVEIEVDIAAGQPPPARIGLHCQLRDVAQNASW
LGLGPHENYPDRRLAAEFSRWQLPLEALSTPYVFPSENGLRGGTRELIFGRWQIGGDFHF
SLSRHSVEQLRQTSHRHLLRDEPGCWLILDGYHMGVGGDDSWSQSVNEEFLLSARQYRYQ
LTLARH
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atggccagtcgtgatccactcaccttgcagcagctattatcccagcgccactgggaaaac
ccggcactgacccagcttaaccggctgccgacccatacgccgcttgccagctggcgcagt
gaagatgctgcgcgcagcgatctgcccagcccgagtatccgagagctggacggagaatgg
ggctttaactatttccaccgtccgcaagcggtgccggatgaatggttgtatcacgatctg
ccccaggtcggcagcatagcagttccgtccaactggcagctggcgggttatgatgctccc
atttataccaacgtgcagtacccgataccggtggccccgccacgcgttcctgaggataat
ccgaccggttgttattcgctcaactttcgttgcccacccgactggctgcaaagcggccag
acgcgaatcatcttcgacggggttaacccggccttttacctgtggtgcaacggcgagttt
attggttactcccaggacagccggctgccggccgaattcgacctcagccacagcctgcgg
gcggaagaaaaccgcattgccgtgatggtactgcgctggtgcgatggcagctatctggaa
gaccaggatatgtggcgcatgagcggaattttccgcagtgtcagcctgctgcataaaccg
gtggtgaggctgaatgacattcagacagatacccggctaagccctgagttacgcagtgca
cggcttcaggtaatggcgttatgttcactgcctgatgccagcgcctggcggcttgaggtg
aagttgtggcacgaagatacgctgattgcacagcagcagcagccgtttggcacgccggtg
gttgacgagcgcggcagctacctcgaccgtacgcggctgtccctgcatatcgaccagccc
ctgctgtggagcgccgaaactccgcatctttaccgtgcggtggttaccctgctggatgct
gatggcagattagttgaagcagaagcctgtgacgttggctttcgacagattgaggtgagc
ggcgggttgctgaaactcaacggcaaagcgctgttgatccgtggcaccaaccgccatgag
caccacccgcatcgcggtcaggtgatggatgagcctgcgatggtcaccgatattctgctg
atgaaacagcataacttcaacgccgtgcgctgctctcattacccgaatcatccgttgtgg
taccgactgtgcgaccgttacgggctgtatgtggtcgatgaagccaatattgaaacgcac
ggaatgcaaccgatgaaccggctggcggacgatccagtctggtttcaagctttcagcgaa
cgggtcattcgcatggtgcaacgcgatcgcaaccatgcctgtattatcatctggtcgctg
ggcaacgaatctggccacggcagtacccacgatgcgctttatcgctgggtcaaaagtaac
gatccaggccggccggtgcagtacgaaggcggcggagccgactccgccgccagcgatatc
atctgcccgatgtatgcgcgggtcgatcaggaccaaccttttgcggccgtgcctaaatgg
tcaataaaaaaatggataggcctgccggaagagacccgcccgttgatcctctgtgaatac
gcccatgcaatgggcaacagccttggcggtttcgaacgttactggcgggcctttcgccag
ttcccccgcctgcagggagggtttatctgggactgggccgaccaaagcctgacgcgccat
gatgccgatggcagcagctggcaagcctatggcggtgactttggcgacacgcctaatgac
cgtcagttctgtatgaacgggctgctctttgccgaccgtagtccgcatccggcactattt
gaagcccaacgcgcccaacagtttttccagtttgctctggtcagtaccgcaccgataatc
gtcagcattaccagtgaatacctgtttcgtcacagcgacaacgaacagctatgctggcgt
attgagcatcaggggaaaggggttgctgaaggccaaattaccttggacctgccgccggaa
ggcactctttgcctgacgctgggtgaactgccctcgttaaccggcgaactttggctgcgg
gtctcggtgatccagcccacagccaccgcatggtcagcggccgggcatcgcgtggcgtgg
gatggctggcggctgccggcggcgctggctctgccacaacctcagatgaccggtgagctg
cctcgtttacatcagcagccgcagctgattgagatcgtccatggtcagcagcgctggcat
ttctgccggcaaagcggtgagctgatacagtggctgcaagcaaatgaaccacagttgctc
tccccgctgcgcgatctgttcgtgcgtgccccgctggataacgatatcggtatcagtcag
gcctcatgcattgacccaaacgcctgggtggagcgctggcaacgtgcgggctatttccag
cttgaaagccggctgctaagcctgcagacggatatcctgagcgacggagtgcaaatccgc
agcgaacaggcatggctgacaggtacagcgttacgtttcctcagtcgcaaatgctaccga
ataaatcttcagggtgaggtgcttgttgaaatcgaagtcgacattgccgccgggcagccg
ccaccagcgcgtattggcctgcactgccagctgcgcgacgtggcgcagaatgccagctgg
ctgggtcttggcccacatgaaaactacccggaccgacggctggcggcagagttctcacgc
tggcagctgccgcttgaagcattgagcacgccttatgttttcccaagtgaaaacggcctg
cggggcggcaccagagaactgatctttggtcgctggcagatcggcggtgatttccacttt
tcgcttagtcgccacagcgttgaacagctgcgtcagacttcgcatcgccatttgctgcgc
gatgaaccgggctgctggctgatccttgatgggtaccatatgggtgtgggcggtgatgac
tcctggagccaaagcgtcaatgaagaatttttgctttccgcccgccagtatcgctatcaa
ttaaccctggcgcgccactga

DBGET integrated database retrieval system