KEGG   Erwinia amylovora CFBP1430: EAMY_1018Help
Entry
EAMY_1018         CDS       T01197                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eam00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    EAMY_1018 (recR)
DNA repair and recombination proteins [BR:eam03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      EAMY_1018 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1093433..1094038
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLETLMESLRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDICTICANPRRRQNGLICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLEKESIQEVILATNPTVEGEATANYIASLCEQYGVDASRIAHGVPVGGE
LEMVDGTTLSHSLVGRQKFKF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagccccctcctcgaaacattaatggagtcgctgcgctgcctgccgggcgtt
gggcctaagtcggctcaacgcatggcttttcagctgttacagcgcgatcgtagcggcggg
atgcgcctggctcaggctttgacgcgggcgatgtcggagatcggacactgtgccgactgt
cggaccttcactgaacaggacatttgcaccatttgcgctaatccacggcgtcggcaaaat
gggctgatttgcgtagtggaaagcccggcagacatccacgccattgagcaaaccgggcag
ttcgctggccgttactttgtactgatggggcatctgtcgccgctggatggtatcgggcca
gatgacatcggccttgaccggctggagcagcggctggaaaaggaatcgattcaggaagtg
atcctcgccaccaatccgacggtggaaggtgaggcaaccgctaactacattgccagcctg
tgtgaacagtacggcgtggacgccagccgcattgcgcatggtgttccggtgggcggagag
ctggaaatggtcgatggcaccacgctgtcgcattcactggtcgggcgtcaaaagttcaaa
ttttga

DBGET integrated database retrieval system