KEGG   Erwinia amylovora CFBP1430: EAMY_1046Help
Entry
EAMY_1046         CDS       T01197                                 

Gene name
tesA
Definition
acyl-CoA thioesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:eam01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1122045..1122728)
Genome map
AA seq 227 aa AA seqDB search
MLTLTDGLTKMMNLKNVFRWHYPFLFLMAFMTLRATAADTLLVLGDSLSAGYRMSASAAW
PALLNEKWQKSPAIINGSISGDTTAQGLARLPALLKQHQPRWVLIELGGNDGLRGFPPQQ
VEQDLSQAIAQIQAAKAQPLLMQVRLPANYGKRYTASFAAIYPKLAGQFAIPLVPFFMEQ
VYLKPGWMQDDGIHPNPAAQPFIAELLAKQLAPLVKQELPDAAGNDG
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctgaccgacggacttactaagatgatgaacctcaagaatgttttccgctgg
cattacccgttcctgtttttaatggcttttatgacgctgcgcgcaacggcggcggatacg
ctgctggtgctgggcgacagcctgagcgccggttaccgcatgtccgccagtgccgcgtgg
cctgcgttactcaatgagaaatggcaaaaatcccccgctatcattaacggtagcataagc
ggcgatactacggcgcaggggctggcccggcttccggcactgctgaagcaacatcagccg
cgctgggtactgattgagctggggggcaacgatggtttacgtgggttccctccgcagcag
gtcgagcaggatctgagtcaggcgattgctcaaatccaggcggcaaaggcgcagccgcta
ttgatgcaggtgcggctgcccgccaactatggcaaacgctataccgcgtcatttgccgct
atctaccccaaactggccggtcagtttgccatcccgctggttcctttcttcatggagcag
gtctatctgaagccaggatggatgcaggacgacggcatccaccccaatccggcggcccag
ccctttattgctgaactgctggcaaaacagctggctcccttagttaagcaggaattaccg
gatgctgcggggaatgatgggtaa

DBGET integrated database retrieval system