KEGG   Erwinia amylovora CFBP1430: EAMY_1165Help
Entry
EAMY_1165         CDS       T01197                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAMY_1165 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAMY_1165 (sdhD)
   00650 Butanoate metabolism
    EAMY_1165 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    EAMY_1165 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1230809..1231159
Genome map
AA seq 116 aa AA seqDB search
MVSNASALGRNGIHDWLLLRAAAMIMTLYVLYILAFIVMSGTLTYDIWRGFFASSFTKVF
TLLTLFSILVHGWIGMWQVLTDYIKPLALRMMLQLVVVVALLVYAIYGTVVVWGAS
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcttctgcactggggcgcaatggcattcatgactggctgctgctgcgt
gccgccgctatgataatgaccctttacgtgttgtacatcctcgcttttatcgtcatgtca
ggcaccctgacctatgatatctggcgtggtttttttgcctcatcctttactaaagtcttc
acccttctgacgttgttttctatcctggtgcacggctggatcgggatgtggcaggtactg
accgactatattaaaccactggcgttgcgcatgatgctgcagctggttgttgtggtagca
ctgttggtgtatgccatttatggaactgttgttgtgtggggtgcgtcatga

DBGET integrated database retrieval system