KEGG   Erwinia amylovora CFBP1430: EAMY_1169Help
Entry
EAMY_1169         CDS       T01197                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00020  Citrate cycle (TCA cycle)
eam00310  Lysine degradation
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01120  Microbial metabolism in diverse environments
eam01130  Biosynthesis of antibiotics
eam01200  Carbon metabolism
Module
eam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EAMY_1169 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    EAMY_1169 (sucB)
Enzymes [BR:eam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     EAMY_1169 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: CBA20119
UniProt: D4HZC6
Position
1236709..1237929
Genome map
AA seq 406 aa AA seqDB search
MSSVDIVVPDLPESVADATVATWHKKTGDSVKRDEVLVEIETDKVVLEVPASADGVLEAI
LEEEGATVISRQALGRLKEGNSGGKETSAKAEANESTPAQRQTASLEEESNDALSPAIRR
LIAEHSLDPAAIKGSGVGGRITREDVEKHLAQAAPATKAAPEAAEAAVPADLANRSEKRV
PMTRLRKRVAERLLEAKNSTAMLTTFNEVNMQPIMALRKQYGEAFEKRHGVRLGFMSFYI
KAVVEALKRYPEVNASIDGTDVVYHNYFDVSIAVSTPRGLVTPVLKDVDALSMADIEKKI
KELAVKGRDGKLTVDELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMAVN
GQVVILPMMYLALSYDHRLIDGRESVGYLVAIKELLEDPARLLLDV
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatatcgttgttcctgacctgcctgagtccgtggctgacgccaccgta
gccacctggcacaaaaaaaccggcgacagcgtcaagcgtgatgaagtgctggtggaaatc
gaaaccgataaagtagtgctggaagtaccggcctctgccgacggcgtgctggaagcgatc
cttgaagaagagggtgccacggtgatttcccgtcaggcgctgggtcgcctgaaagagggc
aacagcggtggcaaagagacctctgccaaagccgaagccaatgaatcgacgccagcacag
cgccagacggcatcgctggaagaagaaagcaacgatgcacttagcccggctattcgtcgc
ctgattgccgagcacagccttgacccggcagcgattaaaggcagcggtgtcggcgggcgc
atcacgcgtgaggacgtggaaaaacatctggcgcaggctgccccggcgaccaaagctgca
cctgaagcggcagaagcggctgtccccgccgatctggcgaaccgcagtgaaaaacgtgtg
cccatgactcgtctgcgcaagcgcgtggccgaacgtctgctggaagcgaagaacagcacc
gccatgctgaccaccttcaatgaagtgaacatgcagccgattatggcgctgcgaaagcag
tatggcgaagcgttcgaaaaacgtcacggcgtccgtctgggctttatgtccttctatatc
aaagcggtagtagaagccctgaagcgttacccggaagtgaatgcgtcaatcgacgggacg
gatgtggtttaccataactactttgacgtcagtattgccgtctctacgccacgcggcctg
gtaaccccggtgctgaaagatgtggatgcgctgagcatggccgatattgaaaagaaaatc
aaagagctggcggtgaaaggccgtgatggcaagctcaccgtcgacgaactgaccggcggt
aacttcactatcactaatggtggtgtctttggttcactgatgtccacgccgatcatcaac
ccgccacagagcgctattcttggtatgcatgcgatcaaagatcgcccgatggcggttaat
ggtcaggtggtgatcttgccaatgatgtatctggcgctctcttacgatcaccgtctgatt
gatggccgtgaatccgttggctatctggtggcgatcaaagagctgctggaagacccggct
cgtctgctgctggacgtctaa

DBGET integrated database retrieval system