KEGG   Erwinia amylovora CFBP1430: EAMY_1189Help
Entry
EAMY_1189         CDS       T01197                                 

Gene name
gpmA
Definition
(GenBank) phosphoglyceromutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00010  Glycolysis / Gluconeogenesis
eam00260  Glycine, serine and threonine metabolism
eam00680  Methane metabolism
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01120  Microbial metabolism in diverse environments
eam01130  Biosynthesis of antibiotics
eam01200  Carbon metabolism
eam01230  Biosynthesis of amino acids
Module
eam_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eam_M00002  Glycolysis, core module involving three-carbon compounds
eam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAMY_1189 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    EAMY_1189 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAMY_1189 (gpmA)
Enzymes [BR:eam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EAMY_1189 (gpmA)
Membrane trafficking [BR:eam04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    EAMY_1189 (gpmA)
Exosome [BR:eam04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EAMY_1189 (gpmA)
  Exosomal proteins of melanoma cells
   EAMY_1189 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CBA20139
UniProt: D4HZE6
Position
complement(1264721..1265473)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRTEAKAAGQLLKKEGFTFDFAYTSVL
KRAIHTLWNILDEVDQVWLPVEKSWRLNERHYGALQGLDKAETANKYGDEQVKQWRRGFA
VTPPELDRADERFPGHDPRYASLTTEQLPTTESLALTIDRVLPYWNESILPRMKSGEKVI
IAAHGNSLRALVKYLDNMSEEEILELNIPTGVPLVYEFDENFKPIKHYYLGDADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaacgaagctggttctggtacgtcacggcgaaagccagtggaacaacgaaaac
cgtttcaccggttggtacgacgttgatctgtcagagaaaggccgcaccgaggcaaaagcc
gccggtcagctgctgaagaaagaaggattcaccttcgattttgcttacacttctgtgctg
aaacgtgccattcataccttgtggaacatcctggatgaagttgaccaggtgtggctgccg
gtcgagaaatcatggcgtcttaacgagcgtcactacggtgcgctgcaaggactggataag
gctgaaaccgctaacaaatacggtgacgagcaggtcaagcagtggcgtcgtggcttcgcc
gttaccccgcctgagcttgatcgtgccgacgagcgcttcccgggccacgacccgcgttat
gcttcattgaccacagaacagttaccgacgaccgaaagtctggcgctgactattgaccgc
gtgctgccatactggaatgaatccatcctgccgcgtatgaaaagcggtgagaaagtgatc
attgctgcgcacggtaactccctgcgcgcgctggtcaaatacctggacaatatgagtgaa
gaagagatcctcgaattaaacatcccaaccggcgtaccgctggtttatgagttcgacgaa
aactttaagccgatcaaacattactatcttggtgatgctgatgaaatcgccgctaaggca
gctgccgtagctaatcagggtaaagcaaagtaa

DBGET integrated database retrieval system