KEGG   Erwinia amylovora CFBP1430: EAMY_1656Help
Entry
EAMY_1656         CDS       T01197                                 

Gene name
btuE
Definition
(GenBank) probable glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00480  Glutathione metabolism
eam00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    EAMY_1656 (btuE)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    EAMY_1656 (btuE)
Enzymes [BR:eam01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     EAMY_1656 (btuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: CBA20606
UniProt: D4I1W5
Position
1721988..1722560
Genome map
AA seq 190 aa AA seqDB search
MSVSKTGKTMNLYETELITLEGEKTSLARWQGDVLLVVNVASKCGLTPQYEALEHLHKML
HQQGLTVMGFPCNAFLQQEPGSEAEIKTFCSTHYGVTFPMFSKINVNGPQRHPLYAQLIA
ARPEATAPENSVFAERMASKGRAPKQHGDVLWNFEKFLIARDGRVVERFSPDMAPNDPLL
LACVEKALAE
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcagcaaaacaggaaaaacaatgaatctgtacgaaactgaactgataacgctg
gaaggtgagaaaaccagcctggcccgctggcagggagatgtcctgctggtggtcaatgtg
gcttcaaaatgtgggctgacaccgcagtacgaagcgctggaacatctacataaaatgctg
caccagcaggggctgacggtgatgggatttccttgcaatgcctttctgcagcaggagccg
ggtagcgaagcggaaataaaaacgttttgcagcacccactacggtgtgaccttcccgatg
ttcagcaaaatcaatgttaacggcccgcagcgccacccgctttacgcgcagctgattgcg
gcccggcctgaagctaccgcgcctgaaaacagcgtatttgccgaacgtatggccagtaaa
ggacgtgcgccgaaacagcatggtgatgttctgtggaactttgagaagtttctcatcgct
cgggatggacgggtggttgagcgtttctctcccgatatggcgcccaacgatccgctgctg
ctggcctgtgtcgaaaaggcgctggcagaataa

DBGET integrated database retrieval system