KEGG   Erwinia amylovora CFBP1430: EAMY_1796Help
Entry
EAMY_1796         CDS       T01197                                 

Gene name
yneH
Definition
glutaminase
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    EAMY_1796 (yneH)
   00330 Arginine and proline metabolism
    EAMY_1796 (yneH)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    EAMY_1796 (yneH)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     EAMY_1796 (yneH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1857622..1858548)
Genome map
AA seq 308 aa AA seqDB search
MISVLDNSLLEEIIQQVRPLIGQGRVASYIPALADVPAERLGIAVCTLDGSVFLAGDAQE
RFSIQSISKVLSLTLALTRYQESEIWQRVGKEPSGQPFNSLLQLELEQGKPRNPFINAGA
LVVCDMLETRLTAPRQRMLEVVRRLSQQPEINYDRHVARSEFEHSARNAAIAWLMKSFGN
FANDVPTVLQTYFHYCSMTMNCVELARCFLYLANHGRGLGQEDAVLTPKQTRQINALMVT
SGMYDGAGEFAWRVGMPGKSGVGGGIIAVVPGEMSIAVWSPELDGSGNSLAGTAALELLA
ERIGRSIF
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgataagcgttctggataacagcttgctggaagagattattcagcaggtacggcccttg
attggtcagggaagggtggccagctatattcccgcgctcgctgatgttccggcagagcga
ctgggaatcgctgtctgtaccctggatggatctgtttttctggcgggagatgcgcaagaa
cgtttctcaattcagtcgatctctaaagtactttctctgacgctggcgctgacgcgctat
caggaaagcgaaatctggcagcgggtgggcaaagaaccctccgggcagccattcaactcg
ctgctacagcttgagctggaacagggtaaaccgcgtaatccttttattaacgcgggtgcg
ctggtggtttgcgatatgctggaaacgcggctgaccgctccccggcagcgtatgctggag
gtggtgcgcaggctttcgcagcagccggagattaactatgaccgccatgtggcgcgttct
gaatttgaacattccgcacgcaatgcggctatcgcctggctgatgaaatcatttggtaat
tttgctaacgatgtgccaacggtgctgcaaacctatttccactactgctctatgactatg
aactgcgttgaactggcgcgctgctttctctatcttgccaatcatggtcggggactggga
caggaagatgcggtgttaaccccgaaacaaacccggcagatcaatgcgttaatggtcacc
agcggcatgtatgatggtgcgggtgaatttgcctggcgcgtgggtatgccgggtaaatcg
ggagtgggcggaggcattattgccgtggtgccgggtgaaatgagcattgcggtgtggtcg
ccggaactggacggatcgggtaattcgctggcaggcaccgcagccctggagctgctggct
gaacgtatcgggcgctcaatcttctga

DBGET integrated database retrieval system