KEGG   Erwinia amylovora CFBP1430: EAMY_1918Help
Entry
EAMY_1918         CDS       T01197                                 

Gene name
trpC
Definition
(GenBank) bifunctional indole-3-glycerol phosphate synthase/phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01130  Biosynthesis of antibiotics
eam01230  Biosynthesis of amino acids
Module
eam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAMY_1918 (trpC)
Enzymes [BR:eam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     EAMY_1918 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     EAMY_1918 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI BtpA
Motif
Other DBs
NCBI-ProteinID: CBA20868
UniProt: D4I3E5
Position
1984815..1986176
Genome map
AA seq 453 aa AA seqDB search
MQQTVLDRIVRDKTDWLAARQQQQPLASFQHEIVPATRNFYEGLKGARTAFILECKKASP
SKGLIREDFDPAVIAGVYRHYASAISVLTDEKYFQGSFDFLPIVSAAVSQPVLCKDFIID
PYQIHLARYYQADAILLMLSVLNDEQYRQLAAVAHSLNMGVLTEAISDEELERATALGAK
VVGINNRDLRDLSIDLDRTRRLAPKVAQGVTVISESGINSYAQVRELSHFADGFLIGSAL
MSEDNLAAAVRRVIIGENKVCGLTRPQDARSALECGAIYGGLIFAAGSPRQIDAARAQEV
MAAAALRYVGVFRNDGLSDVVTIARRLNLHAVQLHGDEDREFISQLRAALPENVQIWKAF
SISTSLPARDWPHVDRYVFDQGNGGSGKAFDWSLLQGEKWDNVLLAGGLSADNCLLAAQQ
GCAGLDFNSGVESAPGIKDAAKMASVFHTLKAY
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgcagcaaaccgtacttgatcgcatcgtgcgcgataaaaccgactggctggcggctcgc
cagcagcagcagcctctggcctcgtttcagcatgagattgtcccggctacgcgcaacttc
tacgaggggctgaagggcgcccgtaccgcgttcattctggagtgcaaaaaagcctcgccg
tccaaaggattgatccgtgaagactttgacccggcggtgattgccggcgtctaccggcat
tacgcctccgccatctcggtgctgaccgatgagaagtactttcagggaagctttgacttt
ctccccatcgtcagtgcagcagtcagtcaaccggtactgtgtaaagactttatcatcgac
ccgtatcagatccatctggcgcgctattatcaggccgacgccattctgctgatgctgtcg
gtactgaatgacgagcagtaccgccagctggccgccgtggcacacagcctgaatatgggc
gtgctgacggaagcgatcagcgatgaagagcttgagcgcgccaccgcgctgggcgcaaaa
gtggtcggcatcaataaccgtgatttacgcgatctgtcaatcgacctcgaccgtacccgc
cgtctggcgccgaaagtggcacagggcgtgacggtcatcagtgaatcaggcatcaacagc
tatgcccaggtgcgcgaactgagtcacttcgccgacggcttcctgataggttcggcgctg
atgtcggaagacaaccttgccgctgcggtcaggcgggtgattatcggtgagaacaaagtc
tgcggactgacccgcccgcaagatgcgcgcagcgcgctggagtgcggggctatctatggc
gggctgatctttgccgccggatcgccgcgccagattgacgccgcacgggcgcaagaggtc
atggccgccgccgcactcaggtacgttggcgtgttccgtaatgacggcctgagtgacgtt
gtcactatcgcgcggcggctcaacctgcacgcggtacagctgcacggtgatgaagatcgc
gagttcattagccagctacgagccgcattgcctgaaaacgtgcagatctggaaagccttc
agcatcagcaccagcctgcccgctcgcgactggccgcacgtcgatcgctacgtatttgac
cagggaaatggcggcagcggtaaagcgtttgactggtcgctgttacaaggtgaaaagtgg
gataacgtcctgctggccggcggcctgagtgcggacaactgccttctggccgcacagcag
ggctgtgccggtctcgactttaattccggcgtggagagcgctcccggaatcaaagatgca
gcaaaaatggcttccgtgttccatacgttgaaagcctactga

DBGET integrated database retrieval system