KEGG   Erwinia amylovora CFBP1430: EAMY_1920Help
Entry
EAMY_1920         CDS       T01197                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00260  Glycine, serine and threonine metabolism
eam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01130  Biosynthesis of antibiotics
eam01230  Biosynthesis of amino acids
Module
eam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAMY_1920 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAMY_1920 (trpA)
Enzymes [BR:eam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAMY_1920 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth
Motif
Other DBs
NCBI-ProteinID: CBA20870
UniProt: D4I3E7
Position
1987381..1988187
Genome map
AA seq 268 aa AA seqDB search
MDRYDLCFKRLAAKQEGAFVPFVTLGDPTPELSLQIIDALVAGGADALELGIPFSDPLAD
GPTIQSANLRAFAAGVTPEQCFELLAVIRQKYPQLPIGLLMYANLVFSNGIDNFYARCQQ
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNAGDDLLREIASHGRGYTYLLSRA
GVTGSETRASLPLRHLVDKLREYHAAPALQGFGISEASQVQQAIAAGAAGAISGSAVVKI
IEKHLADPALMLSELTAFAARLKDATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttacgacctctgttttaaacgtctggccgcaaagcaggaaggggcgtttgtc
cccttcgtcaccctcggcgacccgacgcccgaactgtcgttacagattatcgatgcgctg
gtggcgggcggtgccgatgcccttgagctgggtattcccttttctgacccgctggcagat
ggccccaccatccagagtgcgaatctgcgcgcctttgctgccggggtaacgccagagcag
tgttttgaactgctggcggttattcggcaaaaatacccacagctgcccattggcctgcta
atgtacgccaacctggtcttctccaacggcattgataacttctatgcccgttgccagcag
gttggcgttgattcggtgctggtagccgacgtgccggttgaggagtctgcgccgttccgc
caggcggccatgcgccataacgttgcaccgatttttatctgcccgccaaacgccggtgac
gatttactgcgcgaaatcgcctctcacggccggggttatacttacctgctgtcgcgcgcc
ggggtgaccggttcagaaacccgtgccagtcttccgctcagacatctggtggataaactg
cgcgagtatcatgctgcccccgcgctgcagggctttggtatttcagaagcctcacaggtg
cagcaggcgattgcggccggggcggccggggctatctcaggttctgccgtggtcaaaatc
attgaaaaacatctggccgatcctgcgctgatgctgtctgaactgaccgcctttgccgcc
cgtctgaaagacgctacccgaagctga

DBGET integrated database retrieval system