KEGG   Erwinia amylovora CFBP1430: EAMY_1920Help
Entry
EAMY_1920         CDS       T01197                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAMY_1920 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAMY_1920 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EAMY_1920 (trpA)
Enzymes [BR:eam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     EAMY_1920 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1987381..1988187
Genome map
AA seq 268 aa AA seqDB search
MDRYDLCFKRLAAKQEGAFVPFVTLGDPTPELSLQIIDALVAGGADALELGIPFSDPLAD
GPTIQSANLRAFAAGVTPEQCFELLAVIRQKYPQLPIGLLMYANLVFSNGIDNFYARCQQ
VGVDSVLVADVPVEESAPFRQAAMRHNVAPIFICPPNAGDDLLREIASHGRGYTYLLSRA
GVTGSETRASLPLRHLVDKLREYHAAPALQGFGISEASQVQQAIAAGAAGAISGSAVVKI
IEKHLADPALMLSELTAFAARLKDATRS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggatcgttacgacctctgttttaaacgtctggccgcaaagcaggaaggggcgtttgtc
cccttcgtcaccctcggcgacccgacgcccgaactgtcgttacagattatcgatgcgctg
gtggcgggcggtgccgatgcccttgagctgggtattcccttttctgacccgctggcagat
ggccccaccatccagagtgcgaatctgcgcgcctttgctgccggggtaacgccagagcag
tgttttgaactgctggcggttattcggcaaaaatacccacagctgcccattggcctgcta
atgtacgccaacctggtcttctccaacggcattgataacttctatgcccgttgccagcag
gttggcgttgattcggtgctggtagccgacgtgccggttgaggagtctgcgccgttccgc
caggcggccatgcgccataacgttgcaccgatttttatctgcccgccaaacgccggtgac
gatttactgcgcgaaatcgcctctcacggccggggttatacttacctgctgtcgcgcgcc
ggggtgaccggttcagaaacccgtgccagtcttccgctcagacatctggtggataaactg
cgcgagtatcatgctgcccccgcgctgcagggctttggtatttcagaagcctcacaggtg
cagcaggcgattgcggccggggcggccggggctatctcaggttctgccgtggtcaaaatc
attgaaaaacatctggccgatcctgcgctgatgctgtctgaactgaccgcctttgccgcc
cgtctgaaagacgctacccgaagctga

DBGET integrated database retrieval system