KEGG   Erwinia amylovora CFBP1430: EAMY_1958Help
Entry
EAMY_1958         CDS       T01197                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eam00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020494..2021111)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYHERGMRTLVYTAELDNRFGVAKVSSRIGLSSPAK
LYNNSTSLFAEISAEHHREPVHCVLVDESQFLTREQVKSLSEVVDMLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICHCGRKASMVLRIDAGGKPFKEGEQVQIGGNERYVS
VCRKHYSEALENGSLQAIYGKQHAD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctttatttctattactcggcgatgaatgccggaaaatcgacagctttgtta
caatcttcctataattaccatgaacgtgggatgagaaccctggtgtataccgccgagtta
gataatcgtttcggcgtggcaaaagtcagttctcgcatcggtctttcatctcctgctaag
ttgtataataacagtacgtcactgtttgcagagataagcgccgagcatcaccgggaacca
gtgcactgcgtactggtggatgaaagccagtttctgacgcgtgaacaggttaaatcatta
tctgaagttgttgatatgttagatatacctgtactctgttatgggttgcgcacggatttt
cgcggtgagttatttacgggtagtcagtatttattagcctggtcggataagctggtagaa
ttaaaaactatctgtcactgcggcagaaaagccagcatggtgttgcgcattgacgcgggg
gggaagccttttaaagaaggtgaacaggtacaaataggcggtaatgagcgttatgtttct
gtatgtcgtaagcattactcagaagcgctggaaaatggttctttacaggctatttatggc
aagcaacatgctgactaa

DBGET integrated database retrieval system