KEGG   Erwinia amylovora CFBP1430: EAMY_1958Help
Entry
EAMY_1958         CDS       T01197                                 

Gene name
tdk
Definition
thymidine kinase
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    EAMY_1958 (tdk)
Enzymes [BR:eam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     EAMY_1958 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2020494..2021111)
Genome map
AA seq 205 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYHERGMRTLVYTAELDNRFGVAKVSSRIGLSSPAK
LYNNSTSLFAEISAEHHREPVHCVLVDESQFLTREQVKSLSEVVDMLDIPVLCYGLRTDF
RGELFTGSQYLLAWSDKLVELKTICHCGRKASMVLRIDAGGKPFKEGEQVQIGGNERYVS
VCRKHYSEALENGSLQAIYGKQHAD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctttatttctattactcggcgatgaatgccggaaaatcgacagctttgtta
caatcttcctataattaccatgaacgtgggatgagaaccctggtgtataccgccgagtta
gataatcgtttcggcgtggcaaaagtcagttctcgcatcggtctttcatctcctgctaag
ttgtataataacagtacgtcactgtttgcagagataagcgccgagcatcaccgggaacca
gtgcactgcgtactggtggatgaaagccagtttctgacgcgtgaacaggttaaatcatta
tctgaagttgttgatatgttagatatacctgtactctgttatgggttgcgcacggatttt
cgcggtgagttatttacgggtagtcagtatttattagcctggtcggataagctggtagaa
ttaaaaactatctgtcactgcggcagaaaagccagcatggtgttgcgcattgacgcgggg
gggaagccttttaaagaaggtgaacaggtacaaataggcggtaatgagcgttatgtttct
gtatgtcgtaagcattactcagaagcgctggaaaatggttctttacaggctatttatggc
aagcaacatgctgactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system