KEGG   Erwinia amylovora CFBP1430: EAMY_1962Help
Entry
EAMY_1962         CDS       T01197                                 

Gene name
galU
Definition
(GenBank) glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00040  Pentose and glucuronate interconversions
eam00052  Galactose metabolism
eam00500  Starch and sucrose metabolism
eam00520  Amino sugar and nucleotide sugar metabolism
eam01100  Metabolic pathways
eam01130  Biosynthesis of antibiotics
Module
eam_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAMY_1962 (galU)
   00052 Galactose metabolism
    EAMY_1962 (galU)
   00500 Starch and sucrose metabolism
    EAMY_1962 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EAMY_1962 (galU)
Enzymes [BR:eam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAMY_1962 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: CBA20912
UniProt: D4I3X5
Structure
PDB: 

Jmol
Position
complement(2024382..2025290)
Genome map
AA seq 302 aa AA seqDB search
MSAYNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVM
CAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCQGAQLNPGDSAPMVGVVEKPKADQAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDSIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLESAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataactcaaaagtaaaaaaagcggttatcccggttgctggtttgggaacg
cgtatgttgcctgctaccaaagcgattccgaaagagatgttgccgctggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgctgggatcaatgagatcgtgctggtt
acgcactcatccaagaactcaattgaaaaccatttcgataccagcttcgagctggaagct
atgctggaaaagcgtgtaaaacgccagctgctggaagaaattcagtcaatttgtccgcca
cacgttaccatcatgcaggtgcgtcaggggctggctaaaggcctgggccacgcagtaatg
tgcgcatggccggtgattggtaacgagccggtagccgttatcctgccggatgtgattctg
gatgaatacgaatcagatttgtcgaaagacaacctggcagaaatgatcagacgcttcgat
gaaactggccacagccagatcatggttgaacccgttgctgacgtcaccgcttacggtgtg
gtggattgccagggcgcgcagctgaacccgggcgacagcgcgccaatggtcggcgtggtg
gaaaaacccaaagccgatcaggccccttcaaatctggcagttgtcgggcgttacgtgctg
tctgcagatatctggccactgctggctaaaacgcctccgggcgccggtgatgaaatccag
ctgaccgactcaattgccatgctgatggagaaagagacggtagaagcttatcacctgaaa
ggtgtgagccatgactgtggtaacaagctcggctacatgcaggctttcgttgaatatggt
gtgcgtcacgaaacactgggcagcgatttcaaagcctggctggaaagcgctgtcggcaac
aaaaagtaa

DBGET integrated database retrieval system