KEGG   Erwinia amylovora CFBP1430: EAMY_1962Help
Entry
EAMY_1962         CDS       T01197                                 

Gene name
galU
Definition
glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAMY_1962 (galU)
   00052 Galactose metabolism
    EAMY_1962 (galU)
   00500 Starch and sucrose metabolism
    EAMY_1962 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    EAMY_1962 (galU)
Enzymes [BR:eam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAMY_1962 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2024382..2025290)
Genome map
AA seq 302 aa AA seqDB search
MSAYNSKVKKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLEEIQSICPPHVTIMQVRQGLAKGLGHAVM
CAWPVIGNEPVAVILPDVILDEYESDLSKDNLAEMIRRFDETGHSQIMVEPVADVTAYGV
VDCQGAQLNPGDSAPMVGVVEKPKADQAPSNLAVVGRYVLSADIWPLLAKTPPGAGDEIQ
LTDSIAMLMEKETVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLESAVGN
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcctataactcaaaagtaaaaaaagcggttatcccggttgctggtttgggaacg
cgtatgttgcctgctaccaaagcgattccgaaagagatgttgccgctggttgataagccg
ttaattcagtatgtcgttaacgagtgtattgctgctgggatcaatgagatcgtgctggtt
acgcactcatccaagaactcaattgaaaaccatttcgataccagcttcgagctggaagct
atgctggaaaagcgtgtaaaacgccagctgctggaagaaattcagtcaatttgtccgcca
cacgttaccatcatgcaggtgcgtcaggggctggctaaaggcctgggccacgcagtaatg
tgcgcatggccggtgattggtaacgagccggtagccgttatcctgccggatgtgattctg
gatgaatacgaatcagatttgtcgaaagacaacctggcagaaatgatcagacgcttcgat
gaaactggccacagccagatcatggttgaacccgttgctgacgtcaccgcttacggtgtg
gtggattgccagggcgcgcagctgaacccgggcgacagcgcgccaatggtcggcgtggtg
gaaaaacccaaagccgatcaggccccttcaaatctggcagttgtcgggcgttacgtgctg
tctgcagatatctggccactgctggctaaaacgcctccgggcgccggtgatgaaatccag
ctgaccgactcaattgccatgctgatggagaaagagacggtagaagcttatcacctgaaa
ggtgtgagccatgactgtggtaacaagctcggctacatgcaggctttcgttgaatatggt
gtgcgtcacgaaacactgggcagcgatttcaaagcctggctggaaagcgctgtcggcaac
aaaaagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system