KEGG   Erwinia amylovora CFBP1430: EAMY_1973Help
Entry
EAMY_1973         CDS       T01197                                 

Gene name
ydjB
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EAMY_1973 (ydjB)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     EAMY_1973 (ydjB)
    3.5.1.-  
     EAMY_1973 (ydjB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2036643..2037257
Genome map
AA seq 204 aa AA seqDB search
MRIRQALLLIDLQNDFCSGGALAVSEGEQTIAVANRLAAEFQQRGEAVIATLDWHPADHG
SFASNAGTIAGTLGDLNGLPQIWWPDHCVQHSQGAQLHPLLDRAAISLLVHKGENAEIDS
YSAFYDNGHRQQTRLHGWLHEHGITALTVMGLATDYCVKFSVMDALDLGYRVTVVRAGCR
GVNLHPDDSENALMTMAQAGAIII
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgagaatacgtcaggcattgttgttaatagacctgcaaaatgacttttgttccggcggg
gctttggccgtcagcgaaggggaacagaccatcgccgtcgctaatcgccttgctgccgaa
tttcagcaacgcggcgaggcagtcatcgccaccctcgactggcatcctgcagatcatggc
agttttgcctctaacgccgggacaatagcgggaaccctgggcgatttgaacgggttacca
caaatctggtggccggatcattgcgtgcagcatagccagggtgcgcagctgcatcctctg
ctcgatcgcgcagcaatcagcctgctggtgcacaaaggtgagaatgcagaaattgatagc
tacagtgcattttatgataatggccatcgccagcagacgcggttacacggctggctgcat
gagcatggcattacggccctgactgtgatgggcctggcgaccgattactgcgtgaagttt
agcgtgatggatgcactggatctgggctaccgggtgacggtggtgagagcgggctgccgt
ggcgtcaatctccatcctgatgacagtgaaaacgccctgatgacgatggcacaggcaggt
gccatcatcatttaa

DBGET integrated database retrieval system