KEGG   Erwinia amylovora CFBP1430: EAMY_1977Help
Entry
EAMY_1977         CDS       T01197                                 

Gene name
yeaD
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAMY_1977 (yeaD)
Enzymes [BR:eam01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     EAMY_1977 (yeaD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2039483..2040361
Genome map
AA seq 292 aa AA seqDB search
MNEKIFSLPVHNQLTPYLSQRQMGELPVMVITHPKVRAAVALQGAHLVAWQPSGEKPVIW
ISDKTPLRDGKAIRGGVPVCWPWFGPAGEPAHGFARNLPWELSAHDENDQCVMLTLALKS
SEKTRKLWPHNFTLFARFRLGERCEIELEAHGEFESTAALHSYFAVADIDGVSVSGLGPN
YIDKVKDGLTGTSDDGVQTYPHCTDRIYTQPENRSIISDKSGERVIEVHHHHHSDVVTWN
PGPERSCSMADMANEGYKTMVCVETAHISQPMISRDDRPARLATTFRVHSKK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaaatattctccctgcctgtgcataaccagttgaccccctacctttcacag
cgacaaatgggcgagttaccggtcatggtcatcacccatccgaaagttcgcgcagccgtc
gcccttcagggcgcccatctggttgcctggcaacccagtggtgaaaaacccgttatctgg
attagcgataaaaccccgctacgtgacggcaaagcgatccgcggcggtgtgcctgtctgt
tggccctggtttggcccggccggcgagccagcacatggctttgcccgtaacctgccctgg
gagctttccgcacatgatgagaacgaccagtgcgtgatgctgacgctggcactgaaaagc
agtgaaaaaaccaggaagttatggccacacaactttaccctgtttgcccggtttcgtctg
ggcgaacgctgtgaaattgaacttgaagcacatggcgaatttgagtcaaccgccgcgctg
cacagttacttcgcggtggctgatatcgatggcgtttcggtcagcggcctggggccgaac
tacattgataaagttaaagatggcctgacaggaacgtctgacgacggcgtacagacctat
cctcattgcactgaccgaatttacacgcagcctgaaaaccgcagcattattagcgataaa
agcggagagcgggtaattgaagttcatcaccaccatcatagtgacgttgtcacctggaat
ccgggaccggagcggtcatgcagcatggccgatatggccaatgagggttataaaaccatg
gtttgtgttgaaacggcgcatattagtcagccaatgatcagccgcgacgacaggccagcc
cgcctggcaaccaccttcagggttcacagcaaaaagtga

DBGET integrated database retrieval system