KEGG   Erwinia amylovora CFBP1430: EAMY_2241Help
Entry
EAMY_2241         CDS       T01197                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    EAMY_2241 (galF)
   00052 Galactose metabolism
    EAMY_2241 (galF)
   00500 Starch and sucrose metabolism
    EAMY_2241 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    EAMY_2241 (galF)
Enzymes [BR:eam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     EAMY_2241 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2279353..2280354)
Genome map
AA seq 333 aa AA seqDB search
MVEARCIFFGLRLYLRIISLMHNEFVFQHHSYGKIMTKLKAVIPVAGLGMHMLPATKAIP
KEMLPVVDKPMIQYIIDECVAAGIKEIVLVTHASKNAVENHFDTSYELEALLEARVKRSL
LSEVKSICPPGVTIMNVRQPQPLGLANALLCARPMLHDEAFVVVLPDVLLDNASADPLRY
NLAAMVARFEETGRSQVLAHHMPDADLSEYSVITTEEPLDFPGKVSSILEFVEKPENPEA
LNSDLAAVGRYVLSADIWPELEALEPGAWGRYQLTDAIVSLNKKTPVDAQLLSGDSFDCG
RKLGYMKAFVTWGLRNHSQGRAFRDEIQKILAK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtcgaagcccgctgtatttttttcggattaagattatacttgcgaatcatctcttta
atgcataatgaatttgtgtttcaacatcattcatatggaaaaattatgaccaagcttaaa
gcagttatcccggttgcaggtctcggaatgcatatgcttcctgcaacaaaagctattcct
aaagagatgctgcccgtcgtcgataagcctatgatccaatacattatcgatgagtgcgtg
gcagcgggtattaaggaaattgttctggtcacccatgcatccaagaatgcggttgaaaac
cattttgatacctcctacgaactggaagccttgcttgaagcccgcgttaaacgctccttg
ctcagcgaggtaaaatctatctgcccaccaggtgtgacgatcatgaacgtgcgccagcca
cagccgctggggctggctaatgctctgttatgcgcccgtccaatgctgcatgatgaagcg
tttgtggtggtgctgcctgacgtgctgctggataatgccagcgccgatccgttgcgttac
aacctggcggcgatggtagcgcgttttgaagaaaccgggcgtagccaggtgctggctcac
cacatgccggacgccgatctttcagagtattcagtgattaccaccgaggagccgttggac
ttcccaggtaaagtgagctccattctggaattcgtagaaaaaccagaaaacccggaagcg
ctgaattccgatctcgccgcagtagggcgttatgtgttgtctgccgatatctggcccgag
ctggaagcgctggagccgggtgcatggggtcgctaccagctaactgatgccatcgtcagt
ttgaataagaaaacgcctgttgatgcgcaactgctcagtggcgatagctttgactgcggg
cgcaaacttggttatatgaaagcttttgttacctggggcttgcgtaatcacagtcagggg
cgtgcgttccgcgatgagatccagaaaattttggccaaataa

DBGET integrated database retrieval system