KEGG   Erwinia amylovora CFBP1430: EAMY_2292Help
Entry
EAMY_2292         CDS       T01197                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eam00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2340837..2341502)
Genome map
AA seq 221 aa AA seqDB search
MATLSQEATLVHQALVARGLETPLRSPGREMDDETRKQLIAGHMTEIMQLLNLDLEDDSL
AETPQRIAKMYVNEVFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
QATVAYIPKDKVIGLSKINRIVQFFSSRPQVQERLTQQILVALQTLLDTSNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRSVRHR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgttgagtcaggaagccacactcgttcatcaggcgctggtcgcccgtggtctg
gaaaccccgctgcgttcaccggggcgtgaaatggacgacgaaacccgcaaacagctgatt
gccggccatatgaccgaaatcatgcagctgctgaatctcgatctggaagatgacagcctg
gcggagacaccgcagcgtattgctaaaatgtacgtcaatgaagtgttttccggcctggat
tatgccaacttcccgaaaatcaccgtgatcgaaaacaagatgaaagtggatgagatggtg
acggtgcgtgatatcacgctgaccagcacctgtgagcatcattttgtgatcatcgatggc
caggccaccgtggcgtatatcccgaaagacaaggtgattggcctgtccaaaatcaatcgc
atcgtgcagttcttctcctcgcgcccgcaggtgcaggagcgactgacacagcagatcctc
gtggcgttgcagacgctgctcgataccagcaacgtggcggtatcgatcgacgcggtgcac
tattgcgtcaaagcacgcgggatccgtgatgccaccagcgccaccaccaccacttcgctg
ggcggactgtttaagtccagccagaatacccgccaggaatttctgcgttcggtgcgtcat
cgttaa

DBGET integrated database retrieval system