KEGG   Erwinia amylovora CFBP1430: EAMY_2292Help
Entry
EAMY_2292         CDS       T01197                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00790  Folate biosynthesis
eam01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    EAMY_2292 (folE)
Enzymes [BR:eam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     EAMY_2292 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CBA21438
UniProt: D4HWS7
Position
complement(2340837..2341502)
Genome map
AA seq 221 aa AA seqDB search
MATLSQEATLVHQALVARGLETPLRSPGREMDDETRKQLIAGHMTEIMQLLNLDLEDDSL
AETPQRIAKMYVNEVFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVIIDG
QATVAYIPKDKVIGLSKINRIVQFFSSRPQVQERLTQQILVALQTLLDTSNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRSVRHR
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgttgagtcaggaagccacactcgttcatcaggcgctggtcgcccgtggtctg
gaaaccccgctgcgttcaccggggcgtgaaatggacgacgaaacccgcaaacagctgatt
gccggccatatgaccgaaatcatgcagctgctgaatctcgatctggaagatgacagcctg
gcggagacaccgcagcgtattgctaaaatgtacgtcaatgaagtgttttccggcctggat
tatgccaacttcccgaaaatcaccgtgatcgaaaacaagatgaaagtggatgagatggtg
acggtgcgtgatatcacgctgaccagcacctgtgagcatcattttgtgatcatcgatggc
caggccaccgtggcgtatatcccgaaagacaaggtgattggcctgtccaaaatcaatcgc
atcgtgcagttcttctcctcgcgcccgcaggtgcaggagcgactgacacagcagatcctc
gtggcgttgcagacgctgctcgataccagcaacgtggcggtatcgatcgacgcggtgcac
tattgcgtcaaagcacgcgggatccgtgatgccaccagcgccaccaccaccacttcgctg
ggcggactgtttaagtccagccagaatacccgccaggaatttctgcgttcggtgcgtcat
cgttaa

DBGET integrated database retrieval system