KEGG   Erwinia amylovora CFBP1430: EAMY_2433Help
Entry
EAMY_2433         CDS       T01197                                 

Gene name
fadJ
Definition
fatty acid oxidation complex subunit alpha
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAMY_2433 (fadJ)
   01212 Fatty acid metabolism
    EAMY_2433 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    EAMY_2433 (fadJ)
   00650 Butanoate metabolism
    EAMY_2433 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    EAMY_2433 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    EAMY_2433 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAMY_2433 (fadJ)
   00310 Lysine degradation
    EAMY_2433 (fadJ)
   00380 Tryptophan metabolism
    EAMY_2433 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    EAMY_2433 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    EAMY_2433 (fadJ)
   00281 Geraniol degradation
    EAMY_2433 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    EAMY_2433 (fadJ)
Enzymes [BR:eam01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     EAMY_2433 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     EAMY_2433 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     EAMY_2433 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2505106..2507253)
Genome map
AA seq 715 aa AA seqDB search
MDLPSALSLTLRPDRVGVITIDVPHEKVNTLKVEFAADILALVRQARANPHLAGLVLISA
KPDSFIVGADISTIAACHHAQQATALAQAGQKAMAEIAALPFPVVAAIHGACLGGGLELA
LACHRRVCSLDDKTRLGLPEVQLGLLPGSGGTQRLPRLTGIRVALEMMLTGKTLDARSAL
RCGLVDETVDHAILLDAAVQLALKPLTTAPRPSLSERLLTSAPGRAVLFTLAQRRTRSQT
HGNYPAAEKILSVVRCGLTPGGSGYSAEAQAFGELVMTPQSAALRSLFFATTGLKKAHFG
VEPHELKRIGVLGGGLMGGGIACITATRAGLPVRIKDINANGINHALKTSWQTLTSAVDR
RRLSAAQRQQQMAFITGGTDYQGFRQCDMVIEAVFEDLALKQKMVAEIEANCSAHTLFAS
NTSSLPIADIAAAAQRPENVIGLHYFSPPEKMPLVEVIPHAGTSAQAIATAVMLARKQGK
TPIVVADRAGFYVNRILAPYIIEALHCLREGEPVEYIDRALVQFGFPLGPLQLLDEVGLD
VGTHIMPILQHAWGERFSLPAGLEALWQDGRKGRKNGRGFYLYPQKGGKKRVDSTLYRLL
PVRVKHHLGAEPVSRRCVMMLLNEAARTLGEQGIASARDGDIGAVMGIGFPPFFGGPFRY
MDQLGSVEVVNCLTQLMQQHGPRFTPCSLLQKMAAEGKTFYQSDVKSDKPADSAG
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggatctgccatctgcattgagccttaccttgcgcccggatcgggtcggcgttatcacc
atcgatgtgccgcatgaaaaggtcaacacgctgaaagtcgaatttgccgccgatattctg
gcgcttgtccggcaggcgcgggcgaacccgcatctggccgggctggtactgatttcggct
aagcctgacagctttattgttggggcggatatcagcacgatcgccgcttgccaccatgca
cagcaggcgaccgcattggctcaggccgggcaaaaggcgatggcggagatagccgcactg
ccgttcccggtcgttgcggctatccacggtgcctgcctcggcggcggccttgaactggcg
ctggcttgccatcgccgcgtctgttcgctggatgataaaacccggcttggcttaccggaa
gtgcagctcggcctgctgccgggttccggcgggacgcagcgtctgccgcgcctgactggc
atccgcgtggcgttagagatgatgttgacgggtaaaacgctggatgcccgtagcgcatta
cgctgcgggctggtggacgagacggtcgatcacgccattctgctggacgcggcagtgcag
ctggcgctaaagccgctcactaccgcgccgcgtccctctctgagcgaacggctgttgacc
agcgcgcccggccgcgcggtgctgtttacgctggcacagcgccggacgcggtcgcaaacc
cacggcaactatccggcggcggaaaaaattctcagcgtggtgcgctgcgggctgacgccg
ggcggcagcggctattcagctgaagcacaggcgtttggtgaactggtgatgaccccgcag
tctgccgcgctgcgcagcctgtttttcgccaccactgggttaaaaaaagcgcactttggt
gttgaaccccatgaactgaaacgcattggcgtactgggcggtggcctgatgggcggcggt
attgcctgcataaccgctactcgtgccgggttgccggtgcgcatcaaagacatcaatgcc
aacggcattaaccatgcgctgaaaaccagctggcagacgctgaccagcgcggtggatcgc
cgccgcctgagcgcggcacagcgccagcagcagatggcctttatcaccggcggcaccgat
tatcagggcttccgccagtgcgatatggtaatcgaagcggtattcgaagacctggcgctg
aagcaaaaaatggtggcggaaattgaagcgaactgcagcgcccatacgctgtttgcctct
aacacctcttctttgcccatagccgacattgccgccgccgcgcagcggcctgagaacgtc
atcggcctgcattatttcagcccaccggagaaaatgccgctggttgaagtgatccctcat
gccggcacctctgcccaggccatcgccaccgcggtgatgctggcacgaaaacagggcaag
acgccaatcgtggtggccgaccgggcgggcttctacgtcaaccgcattctggcaccctat
atcatcgaagcgctgcactgtctgcgcgaaggcgaaccggttgaatatatcgaccgggcg
ctggtgcagtttggttttccccttggcccgttacagctgctggatgaggtcgggctggat
gtcggtacgcatattatgccgatcctgcaacacgcatggggcgaacgcttctcgctgccg
gcggggctggaagcgctatggcaggatgggcgtaaaggccgcaaaaacgggcgtgggttc
tatctgtacccgcaaaaaggcggtaaaaagcgcgtcgacagcacgctgtaccgcctgctg
ccggtcagggtgaaacatcatcttggcgcagagcctgtttcccgccgctgtgtgatgatg
ctgctgaacgaggcggcacgcacgctgggtgagcaggggatcgccagcgcgcgcgatggc
gatatcggcgcggtaatgggtatcggttttccccctttcttcggcgggccgttccgctat
atggaccagctgggcagcgttgaagtggttaattgtttaacgcagctaatgcaacagcac
gggccacgttttaccccttgctccctgctgcaaaaaatggcggctgaaggcaaaaccttt
taccaaagcgacgttaaatctgacaaacctgctgattcagctggttag

DBGET integrated database retrieval system