KEGG   Erwinia amylovora CFBP1430: EAMY_2827Help
Entry
EAMY_2827         CDS       T01197                                 

Gene name
vraB
Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    EAMY_2827 (vraB)
   00630 Glyoxylate and dicarboxylate metabolism
    EAMY_2827 (vraB)
   00640 Propanoate metabolism
    EAMY_2827 (vraB)
   00650 Butanoate metabolism
    EAMY_2827 (vraB)
  Lipid metabolism
   00071 Fatty acid degradation
    EAMY_2827 (vraB)
   00072 Synthesis and degradation of ketone bodies
    EAMY_2827 (vraB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    EAMY_2827 (vraB)
   00310 Lysine degradation
    EAMY_2827 (vraB)
   00380 Tryptophan metabolism
    EAMY_2827 (vraB)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    EAMY_2827 (vraB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    EAMY_2827 (vraB)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    EAMY_2827 (vraB)
Enzymes [BR:eam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     EAMY_2827 (vraB)
Exosome [BR:eam04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   EAMY_2827 (vraB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2917995..2919200)
Genome map
AA seq 401 aa AA seqDB search
MAAAQRLLNYQPEEDWQPVIVAACRTPVGRAYGSLANVPPQALLAPLFGKLLAALPAGFT
AIDEVIIGNATGGGGNIARLAALAAGLPLAVPGVTVDRQCGSGLEAVINACRLVQARAGE
CYLAGGVESVSTAPWRVEKPATLRQMPRFYPRARFSPEEIGDPEMGIAAENVARQCAISR
ERQDRFALRSHQRALAAAQQGAFREEIVALNLDRCQVENDECPRPDTSLARLAALPPVFA
ADGSVTAGNCCPLNDGAALLLVMSRRMARDCGFSQGLLFADACSAGVDPNLLGLGPVPAT
QKLLRRQPGLALDRVEVIEFNEAFAAQVLASVDALGIAEHRINQQGGAIALGHPYGASGA
IMVTRLFSQLVSQRQSEGFGLAMLGIAGGLGLSALFKGVRL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgcacagcgcttactgaattaccagcctgaagaggactggcagccggtgatt
gtcgccgcctgccgcacgcccgtcggcagggcttatggctcgctggccaacgtgccgccg
caggcgctgctggccccgctgtttggcaagctgctggcggcattacccgctgggtttacg
gcgattgatgaggtgattatcggcaacgccaccggcggcggcggcaatattgcccggctg
gcggcgctggcggccgggttaccgctggcggtgcctggcgtgacggtggaccgccagtgc
ggctccgggctggaagcggtgattaacgcctgtcggctggtgcaggccagggcaggtgaa
tgttatctggccggcggggtagagagcgtcagcaccgcgccctggcgggtggaaaagccc
gccacgctaaggcagatgccgcgcttttatccgcgcgcacgtttttcgccggaagagatc
ggcgacccggaaatgggcatcgccgccgagaacgtggcgcgtcagtgcgccatcagccgg
gaacgccaggaccgctttgcgctgcgcagccatcagcgcgcgctggccgccgcgcagcag
ggcgcattccgcgaggagatcgtcgcgcttaaccttgaccgttgccaggttgaaaacgac
gaatgcccacggcctgatacttcgctggcgcggctggcggcgttaccgccggtatttgcc
gccgatggctcggtgacggcgggtaactgctgcccgctgaatgacggcgctgcgctgctg
ctggtgatgagccgccgcatggcgcgggattgcggcttcagccaggggctgctgtttgcc
gatgcctgtagcgcgggggttgacccgaatttactggggcttggcccggttcccgccacg
caaaagctgctgcggcgtcagccgggcctggcgttggatcgggttgaggtgatcgagttt
aatgaggcttttgccgcccaggtgctggcatcggtagatgcgttgggcattgctgaacac
aggatcaaccagcaggggggcgctatcgcactggggcatccttacggcgcttccggggcg
atcatggtaacgcggctgttcagccagctggtaagtcagcggcagagcgaaggcttcggg
ctggcgatgctggggatcgccggtgggctggggttgagcgcgctgtttaagggcgtgcgg
ctgtaa

DBGET integrated database retrieval system