KEGG   Erwinia amylovora CFBP1430: EAMY_2836Help
Entry
EAMY_2836         CDS       T01197                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00010  Glycolysis / Gluconeogenesis
eam00020  Citrate cycle (TCA cycle)
eam00620  Pyruvate metabolism
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01120  Microbial metabolism in diverse environments
eam01130  Biosynthesis of antibiotics
eam01200  Carbon metabolism
Module
eam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAMY_2836 (aceF)
   00020 Citrate cycle (TCA cycle)
    EAMY_2836 (aceF)
   00620 Pyruvate metabolism
    EAMY_2836 (aceF)
Enzymes [BR:eam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     EAMY_2836 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA DUF1223
Motif
Other DBs
NCBI-ProteinID: CBA22507
UniProt: D4HZU1
Position
complement(2926551..2928146)
Genome map
AA seq 531 aa AA seqDB search
MAIEINVPDIGADEVEVTEILVKVGDTVEVEQSILVVEGDKASMEVPSPQAGVVKEIKIA
TGDRVETGKLIMIFEAAGDAAAPAAAQEKQEAAPAAPAAAPAAASAAKEVNVPDIGGDEV
EVTEIMVKVGDKVEAEQSILTVEGDKASMEVPAPFAGTVKEIKISAGDKVSTGSLVMVFD
VEGAAPAAAPAAKAEAPAPAAPVQEEKAAPAAAPAKAEAKSEFAENDAYVHATPVIRRLA
REFGVNLAKVKGTGRKSRILKEDVQSYVKDAVKRAEAPAAGGGMPGMLPWPKVDYSKFGE
VEEVELGRIQKISGANLSRNWVMIPHVTHFDKTDITDLEAFRKQQNAEAEKRKLDVKFTP
VVFIMKAVAAALEQMPRFNSSLSEDAQKLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGI
VELSRELTTISKKARDGKLTAGEMQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSA
MEPVWNGKEFMPRLMMPISLSFDHRVIDGADGARFITIINNTLADIRRLVM
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaattaatgttcctgatatcggggcagacgaagttgaagtcaccgagatc
ctggtcaaggttggcgacacggtagaagttgagcagtcaatactggtggtcgaaggcgac
aaagcatcaatggaagtgccttcaccacaggctggcgtggtgaaagagatcaagattgcc
accggcgaccgggttgaaaccggtaagctgattatgatctttgaagcggcgggcgatgca
gcagcccccgccgcggcgcaagagaagcaggaagcggccccggccgcccctgctgccgcc
ccggcggcggccagcgcggcgaaagaggtgaatgtccctgatatcggcggtgatgaagta
gaagtcaccgagatcatggtgaaagtcggcgacaaggttgaagctgaacagtcaatcctc
accgttgaaggtgacaaagcctcaatggaagtgcctgcaccttttgccggtacggtaaaa
gagatcaaaatcagcgccggcgacaaagtcagcaccggttctctggtcatggtctttgac
gtcgagggcgcggcacctgccgctgctccggcggcgaaagctgaagcgccagcccctgct
gcgcctgtgcaggaagagaaagcggctccggcagcggcgcctgccaaagccgaagcgaag
tctgaatttgcagagaacgatgcctacgtgcacgccacgccggttatccgccgcctggcg
cgtgaatttggcgttaacctggcgaaggttaaaggcaccggccgcaaatcgcgtattctg
aaagaagacgtgcagagctacgtgaaagacgcggtgaaacgcgccgaagcgccagcggct
ggcggcggcatgccgggcatgctgccgtggccgaaagtggactacagcaaatttggtgaa
gttgaagaagtggagctgggccgcatccagaaaatctccggtgctaacctgagccgtaac
tgggtgatgatcccgcacgttacccacttcgataaaaccgatatcaccgatctggaagcg
ttccgtaaacagcagaatgccgaagcagagaagcgcaagctggacgtgaagttcaccccg
gtggtgttcatcatgaaagccgttgccgctgcgctggagcagatgccgcgctttaacagc
tcgctgtctgaagacgcgcagaagctgacgctgaaaaaatacatcaacatcggcgtggcg
gttgatacgccaaacggcctggtggttccggtattcaaggacgttaacaagaaaggcatt
gttgagctgtcgcgtgaactgaccaccatctccaaaaaggcgcgtgatggtaagctgacc
gcaggcgaaatgcagggcggttgcttcaccatttccagcattggcgggctgggaaccacc
cactttgcgccgatcgttaacgcgccggaagtggctatcctcggcgtttccaagtcggcg
atggagccggtatggaacggtaaagagtttatgccgcgcctgatgatgccgatctcgctc
tccttcgaccaccgcgtgatcgacggggccgatggtgcgcgctttatcaccattatcaat
aacacgctggccgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system