KEGG   Erwinia amylovora CFBP1430: EAMY_2892Help
Entry
EAMY_2892         CDS       T01197                                 

Gene name
mraY
Definition
phospho-N-acetylmuramoyl-pentapeptidetransferase
Orthology
K01000  
phospho-N-acetylmuramoyl-pentapeptide-transferase [EC:2.7.8.13]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EAMY_2892 (mraY)
Enzymes [BR:eam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.13  phospho-N-acetylmuramoyl-pentapeptide-transferase
     EAMY_2892 (mraY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2986231..2987313)
Genome map
AA seq 360 aa AA seqDB search
MLVWLAEHLVTFYSGFNVFSYLTFRAIVSLLTALFISLWMGPRMIARLQEMSFGQVVRND
GPESHFSKRGTPTMGGIMILTSITVSVLLWAYPSNPYVWCVLFVLVGYGIVGFVDDYRKV
VRKDTKGLIARWKYFWQSAIALVVAFAMYMIGKGTPATELVVPFLKDVMPQLGLLYLLLA
YFVIVGTSNAVNLTDGLDGLAIMPTVFVAAGFALVAWATGNVKFAEYLHIPYLRHAGELV
IVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLLRQEFLLVIMGGVFVVE
TLSVILQVGSFKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISLMLVLIGLATLKVR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgttagtctggctggccgagcatctggtcactttttattccggctttaacgtcttttcg
tatttgacgtttcgcgccattgtcagcctgctgaccgcactgtttatctctctgtggatg
gggccgcgtatgattgcccgactgcaagagatgtcctttggtcaggtggtgcgtaacgac
ggcccggagtcgcacttcagcaagcgcggtacgccaacgatgggggggatcatgatcctg
acctcgatcaccgtttcagtgctgctgtgggcctatccctcaaacccgtacgtctggtgc
gtgctgtttgtgctggtgggttacggcatcgttggctttgttgatgactaccgtaaagtg
gtacgcaaagataccaaagggttgattgcgcgctggaagtacttctggcagtcggcgatt
gcgctggttgtcgctttcgccatgtacatgattggcaaaggtacgccggctaccgagctg
gtggtgccgttcttaaaagacgtgatgccgcaacttggcttgctgtatctgctgctggcc
tactttgtcattgttggcaccagcaatgcggtgaatctgaccgacggtcttgatggcctg
gccattatgccaacggtgtttgtcgccgcgggattcgcgctggtggcctgggctacaggt
aacgtgaagtttgccgaatatctgcatatcccctatctgcgtcatgccggtgaactggtg
attgtctgcaccgcaattgtcggtgccggtttaggcttcctgtggttcaacacctatcca
gcccaggtctttatgggtgacgtcggctcactggcgctgggcggcgcgctgggtaccatc
gccgtgctgctgcgccaggagtttctgctggtgatcatgggcggggtgtttgtggtagaa
acactgtcggtgatcctgcaggtgggttccttcaaactacgcggccagcgtattttccgt
atggctcctattcaccatcattatgaattgaagggctggccggagccgcgcgtcatcgtc
cgcttctggattatttcgctgatgctggtgctgattggcctggcaacgctgaaggtacga
taa

DBGET integrated database retrieval system