KEGG   Erwinia amylovora CFBP1430: EAMY_2980Help
Entry
EAMY_2980         CDS       T01197                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eam00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3078229..3079551)
Genome map
AA seq 440 aa AA seqDB search
MFLPQEIIRKKRDGHALSEEEIRQFINGVRDNSVSEGQIAALAMAIWFRDMTLPERVALT
MAMRDSGSVLSWQALNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPPDDRFRQIIKQTGVAIVGQTRSLAPADKRFYATRDITATVDSI
PLIAASILAKKLAEGLDALVMDVKVGSGALVPTLPQSEELAQAIFGVANGAGCKTTVLLT
DMNQPLASSAGNALEVREAVQFLTGGYRNPRLLEVTMALCSEMLLSGGLAKSGDEARMKL
QAVLDNGAAAGVFARMVAAQKGPADFIERIDSYLPAPMLSKAVYASTSGTVSAMDTRALG
MAVVAMGGGRRRASDSIDYSVGFSELVQLGDKVDGQRPLAVVHAASEAGWQQAAQALQHA
VVVGQVQPAPTPVIYRRISQ
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctgccacaagaaatcatccgcaaaaaacgtgatggtcatgcactgagcgaagaa
gagatccgtcagttcatcaacggcgtgcgtgacaactcggtttcagaggggcagatcgcc
gcgttggcgatggcgatctggttccgggatatgactctgccggagcgtgtggcgctgact
atggcgatgcgtgattccggttcggtactcagctggcaggcgctgaatctcaacggcccg
ctggtggacaaacactcaaccggcggcgttggcgacgtcacgtcgctgatgcttggcccg
atggtggccgcctgtggcggctatgtgccgatgatctccggtcgtgggcttggtcatacc
ggcggcacgctggataaactggaagccattcccggttttgatattttcccaccggacgat
cgctttcgccagattatcaaacagacaggagtggcgatcgtcggccagacccgttcgctg
gctccggcggataagcgcttctatgccacgcgtgatattaccgccacggtagattccatc
ccgcttattgctgcctcgatccttgccaagaaactggctgaaggcctggatgcgctggtc
atggacgtaaaggttggttccggggcgttggtgccgactctgccccagtctgaggagctg
gcgcaggctatttttggcgtagcaaacggtgccggttgtaaaaccaccgtgctgttaacc
gatatgaaccagccgctggcttccagtgccggtaatgcgctggaagtgcgtgaagcggtg
cagttcctgaccggcgggtatcgtaatccgcgcctgctggaagtgacgatggcgctgtgc
agcgaaatgttgctctccggcgggctggcgaagtcaggcgacgaagcgcggatgaagctg
caggcggtgctggacaacggcgccgccgccggggtgttcgcgcgcatggtggcggcgcag
aaaggcccggcggactttattgagcgtatcgacagttacctgcccgcgccgatgctaagt
aaagcggtttatgccagcaccagcggcaccgtcagcgcgatggatacccgtgcgctgggg
atggcggtagtggcgatgggcggcggtcgccgccgggccagtgacagcattgactacagt
gttggcttcagcgaactggtgcagctgggcgataaggttgatggccagcgtccgctggcg
gtggtccatgccgccagcgaagccggctggcagcaggcggcgcaggcattgcagcacgcc
gtcgttgtcgggcaggtgcagccggcgccaacgccagttatttatcgcagaatctcgcaa
taa

DBGET integrated database retrieval system