KEGG   Erwinia amylovora CFBP1430: EAMY_3275Help
Entry
EAMY_3275         CDS       T01197                                 

Gene name
acs
Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
eam00010  Glycolysis / Gluconeogenesis
eam00620  Pyruvate metabolism
eam00640  Propanoate metabolism
eam00680  Methane metabolism
eam01100  Metabolic pathways
eam01110  Biosynthesis of secondary metabolites
eam01120  Microbial metabolism in diverse environments
eam01130  Biosynthesis of antibiotics
eam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAMY_3275 (acs)
   00620 Pyruvate metabolism
    EAMY_3275 (acs)
   00640 Propanoate metabolism
    EAMY_3275 (acs)
  Energy metabolism
   00680 Methane metabolism
    EAMY_3275 (acs)
Enzymes [BR:eam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EAMY_3275 (acs)
Lipid biosynthesis proteins [BR:eam01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EAMY_3275 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CBA23379
UniProt: D4I282
Position
3382510..3384465
Genome map
AA seq 651 aa AA seqDB search
MSHSHIYPIPANIAQNTLINPRQYHLMYQQSIQDPEAFWGEQGKILDWIKPYATVKNTSF
APGNISIRWYEDGTLNLAANCLDRHLAARGDRPAIIWEGDDASESKTITYRELHHDVCRF
ANALQALGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSHA
RLVITADEGVRAGRTIPLKQNVDDALTDRGVTSVDKVIVLRRTGKDIHWHHGRDLWWHER
MNSASEQHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPEDI
YWCTADVGWITGHSYLLYGPLACGATTLMFEGVPNWPKPSRMAEVVDKHQVTILYTAPTA
VRALMAEGDKAIAGTHRSSLRILGSVGEPINPEAWEWFHQKIGNGRCPISDTWWQTETGG
FMIAPLPGATALKPGSATHPFFGVQPALVDNEGNLQEGASEGNLVIVDSWPGQARTLFGD
HQRFEQTYFSTFKNRYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHALKGQAIYAYITLNSGEEPSPQLYSEVRAWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPGVVDKLLEEKLSIKMP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccattcacatatttaccctatcccggccaacattgcgcaaaatacgctgataaat
ccccggcagtatcacttaatgtatcagcaatcgatacaggaccccgaggcattttgggga
gagcaaggcaagatcctggactggataaaaccttacgctacggtaaagaacacctccttt
gcccctggcaatatctccattcgctggtatgaggacggcacgcttaacctggccgccaac
tgcctcgaccggcatctggcagcgcgcggcgatcgcccggcaattatctgggaaggggat
gacgccagcgaaagcaaaaccattacttaccgcgaactgcatcacgacgtatgtcgcttt
gccaatgccctgcaagcgctgggaatcaaaaagggtgatgtggtggcgatctatatgcca
atggtgccagaagccgctgtggcaatgctggcctgcgcgcgcatcggtgccgtgcattcg
gttatctttggcggtttttcaccggaagccgtcgccgggcgaattatcgacagtcatgcc
cgtctggtgatcaccgccgacgaaggcgtgcgtgccggacgcaccattccgctgaagcaa
aacgtcgatgatgctctgactgatcgcggggtgaccagcgtcgacaaagtcattgtcctc
aggcgcaccggcaaagatattcactggcaccacggccgtgacctttggtggcatgagcgg
atgaacagtgccagcgagcagcatcagcctgaagagatgaacgcggaagacccattattc
atcctgtatacctccggttctaccggcaaaccaaagggggtgctgcataccactggcggt
tatctggtttatgccgcgaccactttcaaatacgttttcgattatcacccggaggatatc
tattggtgtaccgccgatgtcgggtggattaccggacacagttacctgctgtacggtccg
ctggcctgtggtgccaccacgctgatgtttgaaggagtgcctaactggccaaaaccaagt
cgtatggccgaagtggtggataaacaccaggtgaccatcctgtatacggcgcccacggca
gtgcgcgcgttaatggccgaaggggataaagcgattgccggcacccatcgttccagcctg
cgcatccttggctcagtaggtgaaccgatcaacccggaggcctgggagtggttccatcaa
aaaatcggtaatggccgatgccccatttcagatacctggtggcagacggaaacaggcggt
tttatgatcgctccgctccccggagccaccgcgctgaaacccggatcggctacccatcca
ttttttggcgtacagccagcgctggtcgataacgaaggtaatctgcaggaaggtgccagc
gaaggcaatctggttatcgttgattcctggcctggccaggcgcgcacgctatttggcgat
catcagcgctttgagcagacctacttctccaccttcaaaaaccgctatttcagcggcgac
ggcgctcgccgtgatgaagacggttattactggataaccggacgcgtcgacgacgtactg
aatgtttccggtcatcggctgggcacggcagagatcgagtccgcgctggtctcgcatccg
aaaattgctgaagccgccgtggtcgggattccacacgctttaaaaggccaggcaatctac
gcctatataacgctgaacagtggtgaagaaccttcgccgcagctgtacagcgaagtgcgt
gcctgggtgcgtaaagagattggccccattgctacgccggacgtgctgcactggaccgat
tcattacccaaaacccgctcggggaaaattatgcgccgtattttacgcaaaattgccacc
ggcgataccagcaatctcggcgatacttctacgctggccgatcccggcgtggtagacaaa
ttactcgaagaaaaactgtcgattaaaatgccataa

DBGET integrated database retrieval system