KEGG   Erwinia amylovora CFBP1430: EAMY_3275Help
Entry
EAMY_3275         CDS       T01197                                 

Gene name
acs
Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eam  Erwinia amylovora CFBP1430
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAMY_3275 (acs)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAMY_3275 (acs)
   00620 Pyruvate metabolism
    EAMY_3275 (acs)
   00640 Propanoate metabolism
    EAMY_3275 (acs)
  Energy metabolism
   00680 Methane metabolism
    EAMY_3275 (acs)
Enzymes [BR:eam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EAMY_3275 (acs)
Lipid biosynthesis proteins [BR:eam01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EAMY_3275 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3382510..3384465
Genome map
AA seq 651 aa AA seqDB search
MSHSHIYPIPANIAQNTLINPRQYHLMYQQSIQDPEAFWGEQGKILDWIKPYATVKNTSF
APGNISIRWYEDGTLNLAANCLDRHLAARGDRPAIIWEGDDASESKTITYRELHHDVCRF
ANALQALGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSHA
RLVITADEGVRAGRTIPLKQNVDDALTDRGVTSVDKVIVLRRTGKDIHWHHGRDLWWHER
MNSASEQHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPEDI
YWCTADVGWITGHSYLLYGPLACGATTLMFEGVPNWPKPSRMAEVVDKHQVTILYTAPTA
VRALMAEGDKAIAGTHRSSLRILGSVGEPINPEAWEWFHQKIGNGRCPISDTWWQTETGG
FMIAPLPGATALKPGSATHPFFGVQPALVDNEGNLQEGASEGNLVIVDSWPGQARTLFGD
HQRFEQTYFSTFKNRYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHALKGQAIYAYITLNSGEEPSPQLYSEVRAWVRKEIGPIATPDVLHWTD
SLPKTRSGKIMRRILRKIATGDTSNLGDTSTLADPGVVDKLLEEKLSIKMP
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagccattcacatatttaccctatcccggccaacattgcgcaaaatacgctgataaat
ccccggcagtatcacttaatgtatcagcaatcgatacaggaccccgaggcattttgggga
gagcaaggcaagatcctggactggataaaaccttacgctacggtaaagaacacctccttt
gcccctggcaatatctccattcgctggtatgaggacggcacgcttaacctggccgccaac
tgcctcgaccggcatctggcagcgcgcggcgatcgcccggcaattatctgggaaggggat
gacgccagcgaaagcaaaaccattacttaccgcgaactgcatcacgacgtatgtcgcttt
gccaatgccctgcaagcgctgggaatcaaaaagggtgatgtggtggcgatctatatgcca
atggtgccagaagccgctgtggcaatgctggcctgcgcgcgcatcggtgccgtgcattcg
gttatctttggcggtttttcaccggaagccgtcgccgggcgaattatcgacagtcatgcc
cgtctggtgatcaccgccgacgaaggcgtgcgtgccggacgcaccattccgctgaagcaa
aacgtcgatgatgctctgactgatcgcggggtgaccagcgtcgacaaagtcattgtcctc
aggcgcaccggcaaagatattcactggcaccacggccgtgacctttggtggcatgagcgg
atgaacagtgccagcgagcagcatcagcctgaagagatgaacgcggaagacccattattc
atcctgtatacctccggttctaccggcaaaccaaagggggtgctgcataccactggcggt
tatctggtttatgccgcgaccactttcaaatacgttttcgattatcacccggaggatatc
tattggtgtaccgccgatgtcgggtggattaccggacacagttacctgctgtacggtccg
ctggcctgtggtgccaccacgctgatgtttgaaggagtgcctaactggccaaaaccaagt
cgtatggccgaagtggtggataaacaccaggtgaccatcctgtatacggcgcccacggca
gtgcgcgcgttaatggccgaaggggataaagcgattgccggcacccatcgttccagcctg
cgcatccttggctcagtaggtgaaccgatcaacccggaggcctgggagtggttccatcaa
aaaatcggtaatggccgatgccccatttcagatacctggtggcagacggaaacaggcggt
tttatgatcgctccgctccccggagccaccgcgctgaaacccggatcggctacccatcca
ttttttggcgtacagccagcgctggtcgataacgaaggtaatctgcaggaaggtgccagc
gaaggcaatctggttatcgttgattcctggcctggccaggcgcgcacgctatttggcgat
catcagcgctttgagcagacctacttctccaccttcaaaaaccgctatttcagcggcgac
ggcgctcgccgtgatgaagacggttattactggataaccggacgcgtcgacgacgtactg
aatgtttccggtcatcggctgggcacggcagagatcgagtccgcgctggtctcgcatccg
aaaattgctgaagccgccgtggtcgggattccacacgctttaaaaggccaggcaatctac
gcctatataacgctgaacagtggtgaagaaccttcgccgcagctgtacagcgaagtgcgt
gcctgggtgcgtaaagagattggccccattgctacgccggacgtgctgcactggaccgat
tcattacccaaaacccgctcggggaaaattatgcgccgtattttacgcaaaattgccacc
ggcgataccagcaatctcggcgatacttctacgctggccgatcccggcgtggtagacaaa
ttactcgaagaaaaactgtcgattaaaatgccataa

DBGET integrated database retrieval system